KEGG   Rattus norvegicus (rat): 171041Help
Entry
171041            CDS       T01003                                 

Gene name
Klc1, Kns2
Definition
(RefSeq) kinesin light chain 1
  KO
K10407  
kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    171041 (Klc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     171041 (Klc1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171041 (Klc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q32
AA seq 560 aa AA seqDB search
MHDNMSTMVYMKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAALRSRKQGLDNVHKQRVAEVLNDPENVEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGMRKMKLGLVK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacaacatgtccacaatggtgtacatgaaggaagagaagctggagaagcttacg
caggatgaaatcatttctaagaccaagcaggtgatccaggggctggaggccctgaagaat
gagcacaactccatcctgcagagtctgctggagacgctgaagtgcttgaagaaggacgat
gagagcaacctggtggaggagaagtccagcatgatccgcaagtccttggagatgctggag
ctcggcctgagcgaggcgcaggtgatgatggccctgtctaatcacctgaatgccgtggag
tccgagaagcagaagctccgagctcaggttcgacgtctgtgccaggagaaccagtggctg
cgggatgaactggccaacacacagcagaagttacagaagagcgagcagtccgtggctcag
ctggaggaggagaagaagcacctggagttcatgaaccagctgaagaaatacgacgacgac
atctctccctcggaagacaaagactctgattcttccaaagagccgttggatgacctcttc
ccgaatgatgaggatgacccaggacaaggaatccagcagcaacacagcagtgctgcggcc
gccgcccagcagggcggctacgagatccctgcccggctgcgcacgctccacaacctggtg
atccagtatgcctcgcaggggcgttacgaggtggcggtgccactctgcaagcaggccctg
gaggacctggagaagacttccggccacgaccaccctgatgtggccaccatgctcaacatc
ctggccctggtgtacagggatcagaacaagtataaagacgcagcaaacctcctgaacgat
gccctggctatccgtgagaaaaccctgggccgagatcaccctgcggtggctgcgaccctc
aacaacctagcagtgctgtacggtaagcgtggcaagtacaaagaggccgagccgctgtgc
aaacgggccctggagatcagggagaaggttctgggaaaggatcaccctgatgttgctaag
caactaaataatctggccttgctgtgccagaaccagggcaagtacgaggaggtggagtat
tactaccagagggccctggagatctaccagacgaagctcggacccgatgatcccaacgtg
gccaagacgaagaataacctggcttcctgttatctgaaacaagggaagttcaaacaagca
gaaacattgtacaaggagattctcacccgcgcacatgaacgggagtttggatctgtggat
gatgaaaacaagcccatatggatgcacgcggaggagagagaggagtgcaaaggaaagcag
aaggacgggtcgtcttttggagagtatggcggctggtataaggcctgcaaagtggacagt
cccaccgtcacaaccaccttgaaaaacctgggagcactttaccgccgccaggggaagttt
gaagctgcggagacactggaggaagctgccctgaggtcacgtaagcagggtcttgacaat
gttcacaaacagagagtggctgaagtgctaaatgaccctgagaacgtggagaagcggagg
agccgggagagcctcaatgtggacgtggtcaagtacgagagtggccctgacggaggggag
gaagtgagtatgagcgtagagtggaatgggatgagaaagatgaagctcgggctggttaaa
tga

DBGET integrated database retrieval system