KEGG   Rattus norvegicus (rat): 171079Help
Entry
171079            CDS       T01003                                 

Gene name
B3galt4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 (EC:2.4.1.62)
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:rno00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:rno00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
20p12
AA seq 371 aa AA seqDB search
MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
PQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFA
DLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELV
SELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVS
EELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRGGLAPTH
CVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGT
LRCRFIAWLNS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagcctcttccggcgcctccttctggcggtcctactactggtgatcatctgg
acactgtttggaccatcgggtttgggggaggagctgctgagcctgtccctggcgtccctt
ctgccagccccagcctcgccaggaccacccctggccctgccccgcctcttgattcctaac
ccccaggcctgtggtggctccggaccccctcctttcttgctcatcctggtgtgtacggcc
ccggagcacctgaaccagagaaacgccattcggggatcttggggcgccattcgcgaggcc
cgcggtttcagggtgcagacgctcttcctcctgggagaacctatgggacagcagtttgct
gacctggcctcagagtcagcagcacagggggatgtcttgcaggcctccttccaggattcc
taccgcaacctcaccctcaagaccctcaccggactgaactgggtgaacaaatactgtcct
atggcccggtacatcctcaagacagatgatgacgtgtatgtcaatgtcccagagctggtg
tcagaactgatacagagaggggggccttcagagcaatggcagaagggcaaagagccacag
gaagagacaacagctgtccacaaagagcacaaaggccaggcagtgccccttctgtattta
ggccgggtgcactggagggtgaggcccactcgaacaccagagtcccggcatcacgtgtca
gaagaactgtggccagaaaactggggtcctttcccaccctacgcctctggcacggggtat
gtattgtctatctctgctgtgcagctcattctgaaggtggccagccgggccccatatcta
cctctggaggatgtctttgtgggagtaagcgcaaggcgagggggccttgcccccacacac
tgtgtcaagttggctggtgctacccactacccactggataggtgctgttacgggaagttc
ctgctgacgtcccacaaggtggatccttggaaaatgcaggaagcctggaagctggtgaga
ggactgaatgggagaaggactgagcccttttgttcctggctccagggatttctgggtacc
ttgaggtgccggttcatagcctggctcaatagttga

DBGET integrated database retrieval system