KEGG   Rattus norvegicus (rat): 171115Help
Entry
171115            CDS       T01003                                 

Gene name
Pde5a, PDE5A2
Definition
(RefSeq) phosphodiesterase 5A (EC:3.1.4.35)
  KO
K13762  
cGMP-specific 3',5'-cyclic phosphodiesterase [EC:3.1.4.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    171115 (Pde5a)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    171115 (Pde5a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     171115 (Pde5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q42
AA seq 833 aa AA seqDB search
MLPFGDKTRDMVNAWFSERVHNIPVCKEGIRAHTESCSCSLPQSPHADNTTPGAPARKIS
ASEFDRPLRPIVVKDSEGTVSFLSDSGKKEQMPLTSPRFDSDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLVSRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCPDSFSRVFQMEWEEVGKSSEPLTREH
DANKINYMYAQYVKNTMEPLNIPDVTKDNRFPWTNENMGHINTHCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEEKTGKIKAFNQNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQALAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDL
NLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLE
TLALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSTMEHHHFDQCLMVLNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNEFSFEDPLQKELFLAMLMTA
CDLSAITKPWPIQQRIAELVAAEFFDQGDRERKELNMEPADLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCLPLLDGCRKNRQKWQALADQQEKTLLNGESGQAKRD
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgttgccctttggagacaaaacgagagacatggtcaatgcatggttttcagagagagtt
cacaacattcctgtgtgcaaggaaggcatccgggcccacaccgagtcctgctcttgctct
ctgcctcaaagtcctcatgcagataataccacccctggagcaccagccagaaaaatctct
gcctctgaatttgaccgacctcttagacccattgttgtcaaggattctgagggaaccgtg
agctttctctctgactcaggaaaaaaggaacagatgccactaacctctccaagatttgat
agtgatgaaggggaccagtgctcaagactcttggaactagtaaaagatatttccagtcat
ttggatgtcacagccttgtgtcacaaaattttcttgcatatccatggacttatctctgct
gatcgctattccctgttccttgtctgtgaggacagctctaaagacaaatttctcgtcagt
cgcctctttgatgttgctgaaggttcaacactggaggaagcttcaaataactgtatccgt
ttagaatggaacaaaggcattgtgggacatgtggcagcttttggagagcccttgaacatc
aaagatgcctatgaggatccccggttcaatgcagaagttgaccaaattacaggctacaag
acacaaagtatcctttgtatgccaattaagaaccacagggaagaggtcgttggtgtagct
caggccatcaacaagaaatcaggaaacggtgggacattcactgaaaaagatgaaaaggac
tttgctgcctatctggcattttgtggcattgttcttcacaacgcccagctctatgaaacg
tcactgctggagaacaaaagaaatcaggtattacttgaccttgctagcttaattttcgag
gagcagcagtcattggaagtaattctgaagaaaatagccgccactattatctccttcatg
caggtgcagaagtgcaccatcttcatcgtggatgaagactgccctgactcgttctctcgt
gtgtttcaaatggagtgggaggaagtagggaaatcctccgagcctttgacaagggagcac
gatgcaaacaaaatcaattacatgtatgctcagtatgtcaaaaacacgatggagccactt
aatatcccagatgtcaccaaggacaacagatttccctggacaaatgaaaacatgggccat
ataaacacgcactgcatcagaagtttgctttgcacgcctataaaaaatgggaagaagaac
aaagtcataggggtttgccaacttgttaataagatggaggagaagactggcaagattaag
gctttcaaccaaaacgatgaacaattcctggaggcttttgtcatcttctgtggcttgggg
atccagaacacacagatgtacgaagcggtggagagagccatggccaagcagatggtgacg
ttagaggtcctgtcttatcacgcatcagcggcggaggaagaaacaagggagctccaggct
ctagcggctgctgtggtaccgtctgcccaaacccttaaaattaccgacttcagcttcagt
gacttcgagctgtctgatctggaaacagcgctgtgtacaattcggatgttcactgacctc
aaccttgtgcagaacttccagatgaaacacgaggttctttgccgatggattttgagtgtc
aagaagaattatcggaagaacgttgcctaccacaattggaggcacgcctttaacacggca
cagtgcatgtttgctgctctgaaagcaggcaagattcagaacaagttgacggatctggag
acgcttgcattgctgattgccgctttaagccatgatttggaccatcgtggtgtgaacaac
tcatacatacagcggagcgagcaccccctggcccagctgtactgccactccaccatggag
caccatcacttcgaccagtgcttgatggttctaaacagcccaggcaaccagatcctcagt
ggcctctccattgaagaatataagaccacattgaaaataatcaagcaagcaattttagcc
actgacctagcactgtacattaagagacgaggagaattttttgaacttataagaaaaaat
gaattcagttttgaagatcctcttcaaaaggagttgtttctggcaatgctgatgactgcc
tgtgatctctccgccattactaagccctggcctattcaacaacggatagcagaactcgtg
gcagccgaattctttgatcaaggagacagagagagaaaagaacttaacatggagcccgct
gatctaatgaacagggagaagaaaaataaaatcccaagtatgcaagttgggttcatagac
gccatctgcttgcagctgtatgaggccctgacccacgtctcagaagactgtttgcccctg
ctggatggctgcaggaagaacaggcagaaatggcaagccctcgcagaccagcaggagaag
acgctccttaatggggagagcggccaggccaagcgggactga

DBGET integrated database retrieval system