KEGG   Rattus norvegicus (rat): 171142Help
Entry
171142            CDS       T01003                                 

Gene name
Ehhadh, 1, Lbp, MEF, Mfe, Mfe1, Pbe, Pbfe, perMFE-1
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase (EC:1.1.1.35 5.3.3.8 4.2.1.17)
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    171142 (Ehhadh)
   01212 Fatty acid metabolism
    171142 (Ehhadh)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    171142 (Ehhadh)
   00650 Butanoate metabolism
    171142 (Ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    171142 (Ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    171142 (Ehhadh)
   00310 Lysine degradation
    171142 (Ehhadh)
   00380 Tryptophan metabolism
    171142 (Ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    171142 (Ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    171142 (Ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    171142 (Ehhadh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     171142 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     171142 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     171142 (Ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 722 aa AA seqDB search
MAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAG
ADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVG
LPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEA
IKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASV
KHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVG
VLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKP
KLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASS
TDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVG
NRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTG
PSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLS
QYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKG
GPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
KL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggcgatgatccgcctctgcaacccgcca
gtcaacgccgtcagtccaactgtaatcagggaagtaagaaatggactccagaaagctgga
tcagaccacacggttaaagccattgtgatctgtggcgcaaacggaaacttctgtgcaggt
gctgatatccatggctttagtgcttttacccctggccttgcattaggaagcttggtagat
gaaatacagagataccagaagccggtgttggccgctatccaaggtgtggctctcggagga
ggactggagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgtcggc
ttgccagaagtcacactggggattcttcctggtgcaagaggaacccagcttctccccagg
gtcgttggagttcctgttgctcttgacctaattacctcaggaaaatatctttcagcagat
gaagcactcaggcttggaattctggatgcagtcgtgaagtcagacccagttgaagaagcc
atcaaatttgctcagaagattatagataaacccatagaaccccgcaggatctttaacaag
ccagttccaagcttgcccaacatggacagtgtttttgcagaagccatcgccaaggtacga
aaacagtaccctggtgtcctggctccggagacgtgtgtccgctcaatccaggcctctgtg
aagcatccctacgaagtaggcatcaaggaagaggaaaagctgtttatgtacctccgggca
tccgggcaggctaaagccctacagtatgccttctttgctgaaaagtctgcaaataagtgg
tcaactccctcaggagcgtcttggaaaacagcctctgctcaacccgtctcctcagttggc
gttcttggcttgggaacgatgggccgaggcatcgccatttcttttgcgagagtggggatc
tctgtggttgctgtggagtcagacccaaagcagctagatgctgcaaagaagataatcact
ttcaccttggagaaggaagcatccagagcgcatcagaacggccaagcttcggcaaaacca
aaactcaggttctcctcatccacaaaggaactttcaactgtggatttggtggttgaagca
gtgttcgaagacatgaacctgaagaaaaaggtctttgctgagctgtcagccctgtgcaag
ccaggagcctttctgtgcaccaatacctcggcgctgaacgtggacgacattgcttcttcc
acagatcgccctcagctggtgattggcacccacttcttctcaccagcccatgtcatgagg
ttgctagaggtcattcctagccgatactcttcccctactaccatcgccacggttatgagc
ttgtccaaaaagatcggaaagattggagtagtggttggcaactgctatggatttgttggg
aatcggatgttggctccctattacaaccaggggtttttcttgttagaggaaggtagcaag
ccagaggatgtagacggggtcttggaagagtttggttttaaaatgggacccttcagagtg
tcagacctcgcagggctagatgtgggttggaaaattcgcaaggggcaaggccttactgga
ccatcattgccaccagggacccccgtccgaaagaggggcaacagcaggtactccccactt
ggcgatatgctctgtgaagctgggcggtttggtcagaagacaggtaaaggctggtatcag
tatgacaagccactgggtcgcatccacaaacctgatccctggctttctacgttcctgtca
caatatagagaggttcaccacatcgagcagcgcaccatcagcaaggaggagatcctggag
cgttgcttatattccctcatcaatgaggcgttccgcatcttggaggaggggatggctgct
cgcccagagcacattgatgtcatctacttgcacgggtacgggtggccaaggcacaagggc
gggcccatgttctatgctgcctcagttgggttgcccacagttctagagaaactgcagaaa
tattacaggcagaaccctgacatcccccagctggagcccagtgactacctcagaaggctg
gtagcccagggaagccctcctctgaaggaatggcaaagcttggcagggccccacggcagc
aaactgtga

DBGET integrated database retrieval system