KEGG   Rattus norvegicus (rat): 171143Help
Entry
171143            CDS       T01003                                 

Gene name
Trpm4, LTrpC-4, Mls2s
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 4
  KO
K04979  
transient receptor potential cation channel subfamily M member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    171143 (Trpm4)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   171143 (Trpm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q22
AA seq 1208 aa AA seqDB search
MVGQEKEQSWIPKIFRKKVCTTFIVDLHDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVT
EWNSDEHTTEKPTDAYGDLDFTYSGRKSSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVV
SVLGGSEGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTG
GSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGT
YGRMGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIEGDEKMLKRIEDATQAQLPCL
LVAGSGGAADCLVETLEDTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKE
LLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQ
WRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQ
ASHASSSKSPPANGAAELRPPNVGQVLRTLLGETCAPRYPARNTRHSLLGQDHRENDSLL
MDWANMQQDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARL
EWEAEEAARRKDLAAKFESMSVDLFGECYHNSEYRAARLLLRRCPLWGEATCLQLAMQAD
ARAFFAQDGVQSLLTQKWWGEMDSTNPIWALLLTFFCPPLIYTNLILFRKSEEEPTQKDL
DFDMDSSMNGAGPLGPAEPSAKVALERRRRRRPGHTLCCGGCSKRWSYFWGAPVTAFLGN
VVSYLLFLLLFAHVLLVDFQPTKPGVFELLLYFWAFTLLCEELRQGLGGGWGTLANGGPG
PGKAPLRHRLHLYLLDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFMIFTLRL
LHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRV
FYRPYLQIFGQIPQEEMDVALMNPSNCSAERGSWAHPEGPVAGSCVSQYANWLVVLLLIV
FLLVANILLLNLLIAMFSYTFNKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHLR
LLFKWLRRCHRTNLPASPVFEHFRVCLSKEAERTLLTWESVHKENFLLAQARDKRDSDSE
RLKRTSQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAEALSHSALLPPGGPPP
PSPTGSKD
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggtggggcaggagaaagagcagagttggatccctaagatcttcaggaagaaggtgtgc
acgacgttcatagtggacctccacgatgatgcgggagggaccttgtgccagtgtgggcaa
cctcgggatgcccacccttctgtggctgtggaggatgcctttggggcagccgtagttacc
gagtggaacagtgatgagcacaccacggagaagcccacagatgcctacggggacctggac
ttcacatactctggccgaaagtccagcaacttcctccggctgtctgatcgcacggatccg
gccactgtgtacagtctcgtcacccgctcttggggctttcgtgctccaaacttggtggtg
tcagtgctgggggggtcggagggccccgtgctacagacctggctgcaggaccttctgcgt
cgtgggctggtgcgagcagcccagagcacaggggcctggatcgtcactgggggactgcac
acaggcattggtcggcatgtgggtgtggctgtgagggaccaccagacggccagcaccggg
ggcagcaaggtggtggccatgggtgtggccccctggggagtggtccggaacagagacatg
ctgatcaaccccaagggctcattccctgcaagataccggtggcgtggtgaccctgaggac
ggagttgagttccccctggactataactattctgctttcttcttggtggatgatggtacc
tatggccgcatgggtggtgagaaccgcttccgccttcggtttgagtcctatgtggctcag
cagaagaccggagtgggagggactggaattgacatccctgtactccttcttctcatcgaa
ggcgatgagaagatgttaaagcggatagaggatgccacccaggctcagctcccctgcctc
ttggtggctggctctgggggtgctgcagactgcctggtggagaccctggaagatactctg
gccccagggagtgggggactcaggcgaggtgaagcccgggatcgaattagacgttacttc
cctaaaggagaccccgaggtcctgcaggcccaggtagagaggatcatgacccgaaaggag
ctgctgacagtctattcatcagaggacggctccgaggagtttgagactatcgttttgagg
gctcttgtgaaagcctgtgggagctccgaggcctcggcttacctggatgaactgcgtttg
gctgtggcttggaaccgcgtggacatcgcccaaagtgaacttttccgtggggacatccag
tggcggtccttccacctggaggcctctctcatggacgctctgctgaatgaccggcctgag
tttgtgcgcttgctcatctcccatggccttagtctgggacacttcctgacccccgtgcgc
ctggcccagctgtacagcgcagtgtcccccaactcgctgatccgcaatcttctggaccag
gcgtcccacgctagtagcagcaaatctccacctgcaaatggagctgcagagctccggcct
cctaatgtggggcaagttctgaggactctgttgggagaaacgtgtgcaccgcggtacccc
gccaggaacacccgacactccctgctgggccaggaccacagagagaatgactctctgctc
atggactgggccaacatgcaacaggatgcaagctttgaacaagccccctggagtgacctg
cttatctgggctctgttgttgaaccgagcccagatggccatttatttctgggagaagggc
tccaactcagtggcctctgctctcggggcttgtctcttactccgagtgatggctcgcctt
gagtgggaggctgaggaagctgcacggcggaaggaccttgctgccaagtttgaaagcatg
agcgtggacctctttggagagtgttaccacaacagtgaatatcgagcagcccgccttctt
ctgcgtcgctgtcccctctggggagaggccacctgtctccagcttgccatgcaggctgac
gcccgtgcgttctttgcccaggatggagtacagtctctgctgacacagaagtggtggggg
gagatggacagcacgaaccctatctgggccctgcttctcaccttcttctgcccgcctctc
atctacaccaacctcatcctcttcaggaagtcagaggaggagcccacacagaaggatctt
gacttcgatatggacagcagcatgaatggagcaggtcctcttgggcctgcggagccctca
gcaaaggtggcccttgagaggcggcggcggcggcggccaggacataccctctgctgtggc
gggtgctccaagcgctggtcgtacttttggggcgccccagtgaccgccttcctgggtaac
gtggtcagttacctgctgttcctgctgctgtttgcacacgtgttgctggtggatttccag
cctacaaagccgggcgtcttcgagctgctgctgtacttctgggccttcacgctgctatgc
gaggagctgcgccagggcctgggcggtggctggggtaccctggccaacgggggacctggt
cctggcaaagctcccctgcgccatcgtctgcacctctacctcttggatacttggaaccag
tgcgacttgctggcactcacctgcttcctgctgggcgttggctgcaggctgactcctggc
ctgtttgacttgggacgcacagtcctctgtcttgacttcatgatcttcacactgcgcctg
ctgcacatcttcacggtgaacaagcagctggggcccaagattgtcatcgtgagcaagatg
atgaaggatgtattctttttcctcttcttcctctgcgtgtggcttgtagcttatggggtg
gccacagaggggatcctgaggccccaggaccgcagtctaccgagcatcctgcgcagggtc
ttctaccgtccgtatctgcagatcttcggacaaattccccaggaggaaatggatgtggcc
ctcatgaatcccagtaactgctctgccgagcggggctcctgggctcacccggaggggccg
gtcgcaggctcctgtgtgtcccagtatgccaactggctggtggtgttgctcctcatcgtc
ttcttgctggtggccaatatcctgctgctcaatctgctcatcgccatgttcagctacacc
ttcaacaaagtgcatggcaacagcgacctctactggaaggcgcagcgctacagcctcatc
cgggaattccattcgcggcctgccctggccccacccctcatcatcatctctcacctgcgt
ctcctcttcaagtggctgcgcaggtgtcataggactaacttgcccgcctccccagtcttc
gagcacttccgtgtctgtctctctaaggaagcagagaggacgctgctgacttgggagtct
gtgcacaaagagaacttcctattggcacaagctcgtgacaagcgagacagcgactcggag
cgtctgaaacgcacgtcccagaaggtggacactgcactgaagcagctgggacagatcaga
gagtatgaccggcgtctgagggggctggagagagaggtccaacactgttctcgagtcctg
acttggatggctgaggcccttagccactctgccttactgcctccaggggggccaccccct
ccaagccccactgggtccaaagactga

DBGET integrated database retrieval system