KEGG   Rattus norvegicus (rat): 171178Help
Entry
171178            CDS       T01003                                 

Gene name
Adh7
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    171178 (Adh7)
  Lipid metabolism
   00071 Fatty acid degradation
    171178 (Adh7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    171178 (Adh7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    171178 (Adh7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    171178 (Adh7)
   00982 Drug metabolism - cytochrome P450
    171178 (Adh7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    171178 (Adh7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     171178 (Adh7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N NAD_binding_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 171178
NCBI-ProteinID: NP_599156
RGD: 621638
Ensembl: ENSRNOG00000032959
UniProt: P41682
Position
2q44
AA seq 374 aa AA seqDB search
MDTAGKVIKCKAAVLWGTNQPFSIEDIEVAPPKAKEVRVKILATGICGTDDHVIKGTMVS
KFPVIVGHEAVGIVESVGEEVTTVRPGDKVIPLFLPQCRECNPCRNPEENLCIRSDLTGR
GVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKIDAEAPPEKACLIGCGFSTGY
GAAVKTAKVSPGSTCAVFGLGGVGLSVVMGCKAAGASRIIGIDINKDKFQKALDVGATEC
INPRDFTKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKM
LSYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLGQLITHTLPFHNISEGFE
LLYSGQSIRTVLTF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggacactgctggaaaagttattaagtgcaaagcagctgtcctatgggggacgaaccag
cccttctccattgaggacattgaagtggccccaccaaaggctaaggaagttcgtgttaag
attttggccacgggaatctgtggcacagatgaccacgtgatcaagggaacgatggtgtct
aagttcccagtgattgtgggacacgaagcagttgggattgtggagagtgttggagaagag
gtcactacagtgagaccaggtgacaaagtgatccccctctttctaccacagtgtagagaa
tgcaacccctgccgcaacccggaggaaaatctctgcattaggagcgacctgacaggccgt
ggagtattggctgacggcacgaccaggttcacatgcaagggcaaaccagtccagcacttt
atgaacaccagcaccttcactgagtacacggtcctggatgaatcctccgtagctaagatt
gatgccgaggctcctcccgagaaagcctgcttgattggctgtggattttccactggttat
ggggctgctgttaaaactgccaaggtcagccctggctccacctgtgctgtgtttggcctg
ggaggagttggcctgtcagtcgtcatgggctgtaaagcggccggcgcctcccggatcatc
ggaattgacatcaacaaggacaaatttcagaaagccctggatgtaggggccacagagtgt
atcaatcccagggacttcaccaagcccatcagtgaggtgctgtcagacatgacaggcaac
actgtccagtatacttttgaagttatcgggcgccttgagaccatggttgatgccctctca
tcttgccatatgaactatgggaccagcgtggtggtcggggctcctccgtcagccaagatg
ctcagctatgacccaatgctgcttttcactggacggacatggaagggctgcgtctttggt
ggttggaagagcagagatgatgttcccaaattggtgactgaattcctggaaaagaaattt
gacctgggccagttgataacccacaccttgccttttcataacatcagtgaaggatttgaa
ttgctttattcagggcaaagcattcggactgtcctgacattttga

DBGET integrated database retrieval system