KEGG   Rattus norvegicus (rat): 171352Help
Entry
171352            CDS       T01003                                 

Gene name
Cyp3a9, Cyp3a13, P450olf3
Definition
cytochrome P450, family 3, subfamily a, polypeptide 9 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    171352 (Cyp3a9)
   00591 Linoleic acid metabolism
    171352 (Cyp3a9)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    171352 (Cyp3a9)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    171352 (Cyp3a9)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     171352 (Cyp3a9)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP3 family
   171352 (Cyp3a9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12q11
AA seq 503 aa AA seqDB search
MDLIPNFSMETWLLLVISLVLLYLYGTHSHGIFKKLGIPGPKPLPFLGTILAYRKGFWEF
DKYCHKKYGKLWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRNFGPVGILKKAISI
SEDEEWKRIRALLSPTFTSGKLKEMFPIINQYTDMLVRNMRQGSEEGKPTSMKDIFGAYS
MDVITATSFGVNVDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLTPLFEALNVSM
FPRDVIDFFKTSVERMKENRMKEKEKQRMDFLQLMINSQNSKVKDSHKALSDVEIVAQSV
IFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHATYDTLLQMEYLDMVV
NETLRLYPIAGRLERVCKTDVEINGVFIPKGTVVMIPTFALHKDPHYWPEPEEFRPERFS
KKNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALVRVLQNFSFQPCKETQIPLKLSKQ
GLLQPEKPLLLKVVSRDETVNGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatttgatcccaaacttttccatggaaacctggctgctcctggttatcagcctggtg
ctcctctacctatatggaactcattcacatggaatttttaaaaagttgggaattcctggg
cccaaacctttgcctttcttggggacgattcttgcttacaggaagggcttctgggaattt
gacaaatactgccataaaaaatatgggaaattatgggggttgtacgatggtcgacagcct
gtgctagcgatcacggatccagacataatcaaaacagtgctggtgaaggaatgttactct
accttcacaaaccgacggaactttggtccagtgggtattttgaaaaaagccatctccatc
tctgaggatgaagaatggaagagaattcgagccctgctgtctccaaccttcaccagtggg
aagctcaaggagatgttccccatcattaaccagtatacagatatgttggtgagaaacatg
aggcagggatcggaggaaggcaagcccaccagcatgaaagacatctttggggcctacagc
atggatgtgatcacagccacctcatttggagtgaatgttgattcccttaacaacccacag
gacccttttgtggaaaaaatcaagaagctcttaaaatttgatatctttgatccattgttc
ctctcagtgacactttttccattccttaccccactatttgaagcactaaatgtctccatg
tttccaagagatgtcattgacttttttaaaacttcagtagaacgaatgaaagagaatcgc
atgaaagagaaagaaaagcaaagaatggactttcttcagctgatgataaactcccagaat
tccaaagtcaaagactctcataaagcattatccgatgtggagattgtggcccagtcagtt
atcttcatttttgccggctatgagaccactagcagtgctctttcctttgttttgtatttg
ctggccattcaccctgatatacagaagaaactgcaggatgaaattgatgcagctctcccc
aataaggcacatgccacctatgataccctgctacaaatggagtatctagatatggtggtg
aatgaaaccctcagattatatccaattgctggaaggcttgagagggtctgtaagacagat
gttgaaatcaatggggtgttcattcccaaagggactgtggtgatgataccaacctttgct
cttcacaaagacccgcattactggccagagcctgaggaattccgccctgaaaggttcagc
aagaagaatcaggataacatcaatccttatatgtacctgccctttgggaatggacccagg
aactgtattggcatgaggtttgctctcatgaacatgaaagttgctcttgtcagagtcctg
cagaacttctccttccaaccttgtaaggaaactcagatccctttaaaattgagcaaacaa
ggacttcttcaaccagaaaagccactgcttctaaaagttgtgtccagagatgagactgtg
aatggagcttga

DBGET integrated database retrieval system