KEGG   Rattus norvegicus (rat): 171436Help
Entry
171436            CDS       T01003                                 

Gene name
Mk1
Definition
Mk1 protein
Orthology
K05759  
profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    171436 (Mk1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    171436 (Mk1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    171436 (Mk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   171436 (Mk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
16p14
AA seq 125 aa AA seqDB search
MARWQMAPVRTRPLAIVGYKDLPSIWAAIPGKNFVSITLAEFGLMVGKDWSSFFMNSLTL
GGQKMFCDPGLTAASRGIYNGSSYQEHWRNPHLQCHCTMTAKMLLLMGKEGTHGGWINNH
GGWML
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcacggtggcagatggcacctgtcaggacacggccattggccattgtaggctacaag
gatttgccctccatctgggctgccatccctgggaagaacttcgttagcattacacttgct
gagtttggtctcatggtaggcaaagactggtcaagttttttcatgaatagcttgacgctt
gggggccaaaaaatgttctgtgatccaggactcactgctgcaagtcggggaatttacaat
gggtcttcataccaagagcactggaggaacccccaccttcaatgtcactgcaccatgact
gccaagatgctcctgctgatgggcaaagaaggtacccacggtggttggatcaacaaccac
ggtggttggatgttgtga

DBGET integrated database retrieval system