KEGG   Rattus norvegicus (rat): 171522Help
Entry
171522            CDS       T01003                                 

Gene name
Cyp2d4, Cyp2d18, Cyp2d22, Cyp2d4v1, Cyp2d4v2, Cyp2d6
Definition
cytochrome P450, family 2, subfamily d, polypeptide 4 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    171522 (Cyp2d4)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    171522 (Cyp2d4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     171522 (Cyp2d4)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   171522 (Cyp2d4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 500 aa AA seqDB search
MRMPTGSELWPIAIFTIIFLLLVDLMHRRQRWTSRYPPGPVPWPVLGNLLQIDFQNMPAG
FQKLRCRFGDLFSLQLAFESVVVLNGLPALREALVKYSEDTADRPPLHFNDQSGFGPRSQ
GVVLARYGPAWRQQRRFSVSTFRHFGLGKKSLEQWVTEEARCLCAAFADHSGFPFSPNTL
LDKAVCNVIASLLFACRFEYNDPRFIRLLDLLKDTLEEESGFLPMLLNVFPMLLHIPGLL
GKVFSGKKAFVAMLDELLTEHKVTWDPAQPPRDLTDAFLAEVEKAKGNPESSFNDENLRV
VVADLFMAGMVTTSTTLTWALLFMILRPDVQCRVQQEIDEVIGQVRRPEMADQARMPFTN
AVIHEVQRFADILPLGVPHKTSRDIEVQGFLIPKGTTLIINLSSVLKDETVWEKPLRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSN
YGVFGALTTPRPYQLCASPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgccgacggggtctgaactgtggcccatagccatattcacgatcatcttcctg
cttctggtggacctgatgcacaggcgccagcgctggacttctcgctaccctccgggccct
gtgccctggcctgtgctgggcaacctgctgcagatagacttccagaatatgccagcgggc
tttcaaaagctgagatgtcgctttggggacctgttcagcttacagctggcctttgagtcg
gtggttgtactgaatgggctgccagccctgcgagaggcactggtgaaatacagcgaggac
accgctgaccggccaccgctgcatttcaatgaccagtcgggctttggaccacgctctcaa
ggtgtggtcctcgcgaggtatggacctgcctggcgtcagcagcggcgcttctctgtgtcc
accttccgtcactttggcctgggcaagaagtcactggagcagtgggtgacagaggaggcc
agatgcctctgtgctgccttcgctgaccatagtggattccctttcagccctaacactcta
ctggacaaagcagtgtgtaacgtgatcgcgtccctcctctttgcctgccgctttgaatac
aatgacccacgcttcatcaggctcctggacttgctgaaggacactcttgaggaggaatct
ggattcctgcccatgctcctgaatgtgttcccgatgctcctacacatcccagggcttctt
ggcaaggtattctctggaaagaaggccttcgttgccatgctggacgagctgctaactgaa
cacaaggtgacctgggaccctgcgcagccaccccgagatctgactgatgccttcctggct
gaggtggagaaggccaaggggaatcctgagagcagcttcaatgatgagaacctgcgtgtg
gtggtggctgacctgttcatggcggggatggtgaccacctccaccacactgacctgggcc
ctgctgttcatgatcctgcgtccagatgtgcagtgccgagtacaacaggaaatcgatgag
gtcatagggcaggtgcggcgtccagagatggcagaccaggcacgaatgccgttcaccaat
gctgtcatccatgaggtgcagcgctttgcagacattctccctcttggtgtgcctcacaag
acttctcgtgacattgaagtgcagggcttccttatccctaaggggacgaccctcatcatc
aacctgtcctcagtgctgaaggatgagactgtctgggagaagcccctccgcttccaccct
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctccgtgcccgctgggcagccccggcccagcaac
tatggcgtctttggtgctctgaccaccccgcgcccctaccagctctgtgcttcaccccgc
taa

DBGET integrated database retrieval system