KEGG   Rattus norvegicus (rat): 171529Help
Entry
171529            CDS       T01003                                 

Gene name
Kif2c, KRP2
Definition
kinesin family member 2C
Orthology
K10393  
kinesin family member 2/24
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 721 aa AA seqDB search
MESLHARLFPGLSINIQRSNGLIHSANISTVNLEKSCVSVEWTEGGTTKGKEIDIDDVAA
INPELVQLLPLRPKDSLPLQENVTIPKQKRKSVNSKIPGPKEGLRSRSTRISTVSEVRIP
AQENEMEVELPVSTNSRKPFPIHSHPRPSCSTVTELPLLMISEEAEEQAHSTRSTSSANP
GNSVRRKSCIVKEMEKMKNKREEKRAQNSEIRIKRAQEYDNSFPNWEFARMIKEFRVTMD
CNPLTVTDPIEEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYL
ENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSG
KSQNASKGIYAMASRDVFLLKNQPRYRSLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLED
SKQQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRAKGRL
HGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKL
TQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQAVQMET
EEMDASSHGASLTGNEEEELSSQMSSFNEAMTQIRELEERAMEELREIIQQGPSWLELSE
MTDQPDYDLETFVNKAESALTQQAKQAKHFSALQEVIKALRLAMQLEEQASKQINSKKRH
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcttcacgcacgattgtttcccggtctctccatcaacattcaacgcagcaat
gggttaattcacagcgccaatataagcacggtgaacttggagaaatcctgtgtttcagtg
gaatggaccgaaggaggtaccacaaagggcaaagagattgacattgacgatgtggctgcc
ataaacccagagcttgtacagcttcttcccttacgaccgaaggacagtctgccactgcag
gagaacgtaaccatcccaaagcaaaaacgcaagtccgtcaactccaaaattccaggtcca
aaagaaggccttcgaagtcgttccactcgcatatccactgtctccgaagttcgaatccct
gctcaggagaatgaaatggaggtggagctgcctgtgtccacaaactctcgcaagccattt
cccattcacagccaccctaggccctcctgctccacagtgacagaattaccgttgttgatg
atcagcgaggaggcagaagagcaagcccactccacccgaagcacctcttctgcaaaccct
gggaattcagttcggaggaaatcatgtattgtgaaggagatggagaaaatgaagaacaag
cgagaagagaagagggcccagaactcggagataagaataaagcgagctcaggaatatgac
aacagctttccaaactgggaatttgcccggatgattaaggagtttcgggttactatggac
tgtaatcctctcactgtgacagaccctattgaagaacacaggatctgtgtctgtgtcagg
aaacgcccactgaataaacaagaactggccaagaaagaaatcgatgtgatttctgttccc
agcaagtgtctcctcctggtgcatgaacccaagctgaaagtggacttaacgaagtacctg
gagaaccaggctttttgcttcgactttgcctttgatgaaactgcttccaatgaggtcgtc
tacaggttcacagcaaggccactggtacagacgatttttgaaggggggaaagcaacgtgc
tttgcctatgggcagacaggcagtggaaagacacacacaatgggtggagacctgtctggt
aaaagtcagaatgcatctaaagggatctacgcaatggcttcccgggatgtcttccttctg
aagaatcagcctcgctaccggagcttaaacctggaagtttatgtgacgttcttcgagatc
tacaatgggaaggtatttgatctgctcaacaagaaggccaagttacgtgtgctggaggac
agcaagcagcaggtgcaggttgtggggctgcaggagtacctggttacctgtgccgatgat
gtcatcaagatgatcaacatgggcagcgcctgcaggacttcgggacaaacatttgccaac
tccaattcctcccgctcccacgcctgcttccagattcttcttcgagctaaagggagatta
cacggcaaattctctttggtggatctggcagggaatgaacgaggagccgacacgtctagt
gctgaccgacagactcgcatggagggtgcagaaattaacaagtctctcctggctctgaag
gaatgcatccgggcgctgggacagaacaaggctcataccccattccgtgagagcaagctg
actcaggtgctgagggactccttcattggggagaactcgaggacatgcatgatcgccatg
atctcaccggggataagctcctgtgaatacactttaaacacactgagatacgcagacaga
gtcaaggagctgagcccccacagcgggcccagtggagaacaggcagtccagatggagaca
gaggagatggacgccagctctcatggggcctctctgacaggcaatgaagaggaggagctg
tcctcccagatgtccagctttaatgaagccatgactcagatcagggagctggaagagagg
gccatggaagagctcagagagatcatacagcaaggaccaagctggcttgagctctctgag
atgacggatcagccagactatgacttggagaccttcgtgaacaaggcagaatctgccctg
acacagcaggctaagcaggctaagcacttctcagcccttcaagaagtcatcaaggcccta
cgcctggccatgcaactggaagaacaggctagcaaacaaataaacagcaagaaacggcac
caatga

DBGET integrated database retrieval system