KEGG   Rattus norvegicus (rat): 171565Help
Entry
171565            CDS       T01003                                 

Gene name
Stambp, Amsh
Definition
Stam binding protein (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    171565 (Stambp)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     171565 (Stambp)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M67
   171565 (Stambp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q34
AA seq 424 aa AA seqDB search
MSDHADVSLPPQDRVRILSQLGSAVELNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKNVAFPKAEELKTELLKRYTKEYEQ
YKERKKKEEEELARNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEKMIQKQELEKERLK
IVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTSDCNTTLRPAKPPVVDRSLKPG
ALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVL
IPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatgcagatgtgagcctcccaccccaagaccgggtgaggattctgtcgcaa
ctcggtagtgcagttgagttaaatgaagacattccgccccgtcgctactttcgttccggt
gttgagatcatccgcatggcatccatttactctgaagaaggcaacattgaacatgccttt
atcctctacaacaagtacatcacgctgtttattgaaaaacttccaaaacaccgagactac
aaatcggccatcattcccgagaagaaagacgcggtcaagaaattaaagaatgtcgctttc
cctaaagcggaagagctgaagacagaactcttgaagagatacaccaaagagtatgagcag
tataaggagcgaaagaagaaggaagaagaggaacttgcccgaaatatcgccatccagcaa
gaactggaaaaagaaaagcagagagttgcacagcagaagcagaagcagctcgagcaggag
cagttccatgcctttgagaagatgatccagaagcaggagctagagaaagagcggctaaaa
attgttcaagagttcgggaaggtagaccctggcccgtgcgggcctctgctccctgatctg
gaaaagccctgtgtagatgtggcccccagttcacctttctcgcccacgcagacttcagac
tgtaacacaaccctgaggccagctaagccacctgtggtggacaggtccctcaaacctgga
gcattaagcgtcatagaaaatgttcccaccattgaaggcctgcgccacattgtggtgccc
cgcaatctgtgctcagaatttctccagcttgccagcgccaacactgccaaaggcatcgag
acctgtggagtcctctgtggaaaactgatgagaaatgaattcacaatcacacatgttctc
atccccagacaaaatggtgggcctgattattgccacacagagaatgaagaagaaattttc
tttatgcaggatgatcttggactcctcactcttggctggatccacacccatccaacccaa
acggcctttctgtccagtgtggatctgcacacgcactgctcctaccaaatgatgttacca
gagtccatagcaattgtctgctcccccaagttccaggagactggattctttaaattaact
gactatggccttcaagagatttcaacctgccggcagaaaggctttcacccccatggcaga
gacccaccgctgttctgtgactgcagccatgtcactgtcaaagacagaattgtgacgatc
acagaccttcgataa

DBGET integrated database retrieval system