KEGG   Rattus norvegicus (rat): 192213Help
Entry
192213            CDS       T01003                                 

Gene name
Rasgrf1
Definition
RAS protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    192213 (Rasgrf1)
   04010 MAPK signaling pathway
    192213 (Rasgrf1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    192213 (Rasgrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q31
AA seq 1244 aa AA seqDB search
MQKAIRLNDGHVVSLGLLAQRDGTRKGYLSKRSSDNPKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGSICKRMPSPKRGTSSKESDKQHHYFTVNFSNDSQKSLELRTDDSKDCDEW
VAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKAEIAN
LIKDNERIQSNQLVAPEDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RVMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLIQVPMSEKGKINKGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGSKLHLTKNGVISLIDCTLLDDPENMDDDGKGQE
VDHLDFKIWVEPKDSPPFTVILVASSRQEKAAWTSDIIQCVDNIRCNGLMMNAFEENSKV
TVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFL
HSYRVFTDAVVVLDKLISIYKKPITAIPARSLELLFSSSHNTKLLYGDAPKSPRASRKFS
SPPPLAIGTSSPVRRRKLSLNIPIITGGKALELASLGCPSDGYTNIHSPISPFGKTTLDT
SKLCVASSLTRTPEEIDMTTLEESSGFRKPTSDILKEESDDDQSDVDDTEVSPPTPKSFR
NRITQEFPLFNYNSGIMMTCRDLMDSNRSPLSATSAFAIATAGANESPANKEIYRRMSLA
NTGYSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHSQDFETDDLLKYKVICFLEEVMHD
PDLLPQERKAAANIMRTLTQEEITENHSMLDELLLMTEGVKTEPFENHSAMEIAEQLTLL
DHLVFKSIPYEEFFGQGWMKADKNERTPYIMKTTRHFNHISNLIASEILRNEEVSARAST
IEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLFDKLQKLVSSD
GRFKNLRETLRNCDPPCVPYLGMYLTDLAFLEEGTPNYTEDGLVNFSKMRMISHIIREIR
QFQQTTYKIEPQPKVTQYLVDETFVLDDESLYEASLRIEPKLPT
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagccatccgactgaacgatggccacgtcgtgtccctgggactgctggcccag
agagacggcacgcgcaaaggctacctgagcaagaggagttcggacaacccaaaatggcaa
accaagtggtttgcgctgctgcagaacctgctcttctacttcgaaagtgactcgagctct
cggccctcggggctctacctgctggagggcagtatctgcaaacgcatgccctcccccaag
cgagggacctcctccaaggagtccgacaaacagcatcattacttcacagtgaacttctcc
aatgacagccagaagtccctagagctgaggaccgatgactccaaggactgtgacgagtgg
gtggcagcgattgctcgcgccagctacaagatactggccacagagcatgaggcgctcatg
cagaagtacctgcacctgctgcaggtggtggagacagagaagaccgtggctaagcagctg
cgacagcagctcgaggatggcgaggtcgagatcgagcgcctgaaggcagagattgcaaac
ctgatcaaggacaatgaacgtatccagtccaaccagctggttgcccctgaggatgaggac
agtgacatcaagaaaattaagaaggtacagagtttccttcgcggatggctgtgccggcga
aagtggaagaacatcatccaggactacatccggtctcctcatgccgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaagctgaggccgagtacgtgcagcaactacac
atccttgtcaacaattttctgcgcccactgcgcatggccgccagctctaagaaaccccct
ataacacatgacgacgtcagcagtatctttctgaacagtgagaccatcatgttcctgcac
cagatcttctaccaaggcctgaaggcccgtatcgccagctggcccaccctggttctggcg
gacctgttcgacatcctgctgccaatgcttaacatctaccaggagttcgtccgcaaccac
cagtacagtctccagatcctagcacactgcaagcaaaaccgggactttgacaagctcctc
aagcagtatgaggccaagccagactgcgaggagcgcacactggagaccttcctcacctat
ccaatgttccagatccccaggtacatcctgacactccatgagctgctggcccacacacct
catgagcatgtggagcgcaacagcctggactatgccaaatccaaactagaggagctgtcc
agggtcatgcacgacgaagtcagtgagaccgagaacatccgcaaaaacctggccattgag
cgtatgatcaccgagggctgtgagatcctccttgacaccagccagacctttgtgcgccaa
ggttccctcatccaggtgcccatgtcagaaaagggcaagatcaacaagggccgcctgggg
tctctgtcccttaagaaagaaggtgagcgccagtgtttcctgttctccaagcatctcatc
atctgcaccagaggctctggtagcaaactgcacctaaccaagaatggcgtgatttccctc
attgactgcactctactggatgatccagaaaacatggatgatgacggcaaaggacaagag
gtagatcacctggactttaagatttgggtggagccaaaggattccccacccttcacagtc
atcctggtggcctcatccaggcaggagaaggcggcatggaccagtgacatcatccagtgc
gtggataatatccgctgcaacgggctcatgatgaatgcctttgaagaaaattccaaggtc
accgtgccgcagatgatcaagtctgatgcttccttatactgtgatgatgttgacattcgc
ttcagcaaaaccatgaattcttgcaaagtgctgcagatccgctatgccagcgtggagcgc
ctgctggagcgcctgactgatcttcgcttcctgagtattgactttctcaacaccttcctg
cactcctatcgagtcttcaccgatgctgtggtggtcctagacaagctgatcagcatctac
aaaaagcccatcactgcgattcctgccaggtcactggaactcctgttctccagtagccac
aacaccaaacttctgtacggagatgcccccaagtcgcctcgtgccagccgcaagttctcc
tcgccgccgcccttggccatcggcacttcgtccccagtccgccgccggaagttgtctctc
aacattcccatcatcacaggcggcaaggcgctggaactggcttcgctcgggtgcccctcc
gacggctacaccaacatacactcgcccatatctcccttcggcaaaaccacgctggacacc
agcaagctctgtgtggccagcagcttgaccagaacgccggaggagattgatatgaccact
ctagaggagtcatcaggcttcaggaagccgacctcagacatcttgaaagaagagtctgat
gatgaccagagtgatgtagacgacacagaagtgtctccaccaacaccgaaatcattcaga
aacagaatcactcaagagttcccactctttaactacaacagtggaatcatgatgacatgt
cgcgatctgatggacagtaaccgcagccctctgtcagctacctctgcctttgccatagcg
actgcaggagccaatgaaagccccgcaaacaaggagatatatcgaaggatgtctttggcc
aacacagggtattcctctgaccagagaaatatcgacaaagagttcgtgatccgcagagcg
gccaccaaccgtgtactgaatgtgttgcgccactgggtcaccaagcactcccaggacttt
gaaactgacgacctcctcaaatacaaggtgatctgctttctggaagaggtcatgcatgac
ccagaccttctaccacaagagcgaaaggcagcagccaacatcatgaggactctgacccag
gaagaaataactgaaaaccatagcatgctggatgagctcttactaatgacggagggtgtg
aagactgagcccttcgaaaaccactcagccatggagatagcagagcagctgaccctgctg
gatcaccttgtcttcaagagtattccttatgaggaattctttggccagggctggatgaag
gcagataagaatgaaaggacaccttacattatgaaaaccaccagacatttcaaccatatc
agtaacttgatcgcttcagaaattctccgaaacgaggaggtcagtgcaagggcaagcacc
atcgagaagtgggtggctgttgccgacatttgccgctgcctgcacaactacaatgctgtg
ctggagatcacttcctccatcaaccgcagcgcaatcttccgactcaagaagacatggctc
aaagtttctaagcagacgaaatctctgtttgacaagctccaaaagcttgtgtcatcagat
ggccgatttaagaacctcagagaaactttgcgaaattgtgatccaccctgtgtcccttac
ctggggatgtacctgaccgacttggcattcctcgaggaaggaacacccaattacacagag
gacggcctggtcaacttctccaagatgaggatgatctcccatattatccgcgagattcgc
cagtttcagcagactacttacaaaatcgagccccagccaaaggtaactcagtacttagtg
gatgaaacctttgtgttggacgacgaaagtctgtatgaggcctccctccgaattgaacca
aaactccccacatga

DBGET integrated database retrieval system