KEGG   Rattus norvegicus (rat): 192213Help
Entry
192213            CDS       T01003                                 

Gene name
Rasgrf1
Definition
(RefSeq) RAS protein-specific guanine nucleotide-releasing factor 1
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    192213 (Rasgrf1)
   04010 MAPK signaling pathway
    192213 (Rasgrf1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    192213 (Rasgrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q31
AA seq 1244 aa AA seqDB search
MQKAIRLNDGHVVSLGLLAQRDGTRKGYLSKRSSDNPKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGSICKRMPSPKRGTSSKESDKQHHYFTVNFSNDSQKSLELRTDDSKDCDEW
VAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKAEIAN
LIKDNERIQSNQLVAPEDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RVMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLIQVPMSEKGKINKGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGSKLHLTKNGVISLIDCTLLDDPENMDDDGKGQE
VDHLDFKIWVEPKDSPPFTVILVASSRQEKAAWTSDIIQCVDNIRCNGLMMNAFEENSKV
TVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFL
HSYRVFTDAVVVLDKLISIYKKPITAIPARSLELLFSSSHNTKLLYGDAPKSPRASRKFS
SPPPLAIGTSSPVRRRKLSLNIPIITGGKALELASLGCPSDGYTNIHSPISPFGKTTLDT
SKLCVASSLTRTPEEIDMTTLEESSGFRKPTSDILKEESDDDQSDVDDTEVSPPTPKSFR
NRITQEFPLFNYNSGIMMTCRDLMDSNRSPLSATSAFAIATAGANESPANKEIYRRMSLA
NTGYSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHSQDFETDDLLKYKVICFLEEVMHD
PDLLPQERKAAANIMRTLTQEEITENHSMLDELLLMTEGVKTEPFENHSAMEIAEQLTLL
DHLVFKSIPYEEFFGQGWMKADKNERTPYIMKTTRHFNHISNLIASEILRNEEVSARAST
IEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLFDKLQKLVSSD
GRFKNLRETLRNCDPPCVPYLGMYLTDLAFLEEGTPNYTEDGLVNFSKMRMISHIIREIR
QFQQTTYKIEPQPKVTQYLVDETFVLDDESLYEASLRIEPKLPT
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagccatccgactgaacgatggccacgtcgtgtccctgggactgctggcccag
agagacggcacgcgcaaaggctacctgagcaagaggagttcggacaacccaaaatggcaa
accaagtggtttgcgctgctgcagaacctgctcttctacttcgaaagtgactcgagctct
cggccctcggggctctacctgctggagggcagtatctgcaaacgcatgccctcccccaag
cgagggacctcctccaaggagtccgacaaacagcatcattacttcacagtgaacttctcc
aatgacagccagaagtccctagagctgaggaccgatgactccaaggactgtgacgagtgg
gtggcagcgattgctcgcgccagctacaagatactggccacagagcatgaggcgctcatg
cagaagtacctgcacctgctgcaggtggtggagacagagaagaccgtggctaagcagctg
cgacagcagctcgaggatggcgaggtcgagatcgagcgcctgaaggcagagattgcaaac
ctgatcaaggacaatgaacgtatccagtccaaccagctggttgcccctgaggatgaggac
agtgacatcaagaaaattaagaaggtacagagtttccttcgcggatggctgtgccggcga
aagtggaagaacatcatccaggactacatccggtctcctcatgccgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaagctgaggccgagtacgtgcagcaactacac
atccttgtcaacaattttctgcgcccactgcgcatggccgccagctctaagaaaccccct
ataacacatgacgacgtcagcagtatctttctgaacagtgagaccatcatgttcctgcac
cagatcttctaccaaggcctgaaggcccgtatcgccagctggcccaccctggttctggcg
gacctgttcgacatcctgctgccaatgcttaacatctaccaggagttcgtccgcaaccac
cagtacagtctccagatcctagcacactgcaagcaaaaccgggactttgacaagctcctc
aagcagtatgaggccaagccagactgcgaggagcgcacactggagaccttcctcacctat
ccaatgttccagatccccaggtacatcctgacactccatgagctgctggcccacacacct
catgagcatgtggagcgcaacagcctggactatgccaaatccaaactagaggagctgtcc
agggtcatgcacgacgaagtcagtgagaccgagaacatccgcaaaaacctggccattgag
cgtatgatcaccgagggctgtgagatcctccttgacaccagccagacctttgtgcgccaa
ggttccctcatccaggtgcccatgtcagaaaagggcaagatcaacaagggccgcctgggg
tctctgtcccttaagaaagaaggtgagcgccagtgtttcctgttctccaagcatctcatc
atctgcaccagaggctctggtagcaaactgcacctaaccaagaatggcgtgatttccctc
attgactgcactctactggatgatccagaaaacatggatgatgacggcaaaggacaagag
gtagatcacctggactttaagatttgggtggagccaaaggattccccacccttcacagtc
atcctggtggcctcatccaggcaggagaaggcggcatggaccagtgacatcatccagtgc
gtggataatatccgctgcaacgggctcatgatgaatgcctttgaagaaaattccaaggtc
accgtgccgcagatgatcaagtctgatgcttccttatactgtgatgatgttgacattcgc
ttcagcaaaaccatgaattcttgcaaagtgctgcagatccgctatgccagcgtggagcgc
ctgctggagcgcctgactgatcttcgcttcctgagtattgactttctcaacaccttcctg
cactcctatcgagtcttcaccgatgctgtggtggtcctagacaagctgatcagcatctac
aaaaagcccatcactgcgattcctgccaggtcactggaactcctgttctccagtagccac
aacaccaaacttctgtacggagatgcccccaagtcgcctcgtgccagccgcaagttctcc
tcgccgccgcccttggccatcggcacttcgtccccagtccgccgccggaagttgtctctc
aacattcccatcatcacaggcggcaaggcgctggaactggcttcgctcgggtgcccctcc
gacggctacaccaacatacactcgcccatatctcccttcggcaaaaccacgctggacacc
agcaagctctgtgtggccagcagcttgaccagaacgccggaggagattgatatgaccact
ctagaggagtcatcaggcttcaggaagccgacctcagacatcttgaaagaagagtctgat
gatgaccagagtgatgtagacgacacagaagtgtctccaccaacaccgaaatcattcaga
aacagaatcactcaagagttcccactctttaactacaacagtggaatcatgatgacatgt
cgcgatctgatggacagtaaccgcagccctctgtcagctacctctgcctttgccatagcg
actgcaggagccaatgaaagccccgcaaacaaggagatatatcgaaggatgtctttggcc
aacacagggtattcctctgaccagagaaatatcgacaaagagttcgtgatccgcagagcg
gccaccaaccgtgtactgaatgtgttgcgccactgggtcaccaagcactcccaggacttt
gaaactgacgacctcctcaaatacaaggtgatctgctttctggaagaggtcatgcatgac
ccagaccttctaccacaagagcgaaaggcagcagccaacatcatgaggactctgacccag
gaagaaataactgaaaaccatagcatgctggatgagctcttactaatgacggagggtgtg
aagactgagcccttcgaaaaccactcagccatggagatagcagagcagctgaccctgctg
gatcaccttgtcttcaagagtattccttatgaggaattctttggccagggctggatgaag
gcagataagaatgaaaggacaccttacattatgaaaaccaccagacatttcaaccatatc
agtaacttgatcgcttcagaaattctccgaaacgaggaggtcagtgcaagggcaagcacc
atcgagaagtgggtggctgttgccgacatttgccgctgcctgcacaactacaatgctgtg
ctggagatcacttcctccatcaaccgcagcgcaatcttccgactcaagaagacatggctc
aaagtttctaagcagacgaaatctctgtttgacaagctccaaaagcttgtgtcatcagat
ggccgatttaagaacctcagagaaactttgcgaaattgtgatccaccctgtgtcccttac
ctggggatgtacctgaccgacttggcattcctcgaggaaggaacacccaattacacagag
gacggcctggtcaacttctccaagatgaggatgatctcccatattatccgcgagattcgc
cagtttcagcagactacttacaaaatcgagccccagccaaaggtaactcagtacttagtg
gatgaaacctttgtgttggacgacgaaagtctgtatgaggcctccctccgaattgaacca
aaactccccacatga

DBGET integrated database retrieval system