KEGG   Rattus norvegicus (rat): 192268Help
Entry
192268            CDS       T01003                                 

Gene name
Gls2, Ga
Definition
glutaminase 2 (liver, mitochondrial) (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    192268 (Gls2)
   00330 Arginine and proline metabolism
    192268 (Gls2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    192268 (Gls2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    192268 (Gls2)
  Nervous system
   04724 Glutamatergic synapse
    192268 (Gls2)
   04727 GABAergic synapse
    192268 (Gls2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    192268 (Gls2)
   05206 MicroRNAs in cancer
    192268 (Gls2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     192268 (Gls2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q11
AA seq 602 aa AA seqDB search
MRSMRALQNALSRAGSHGQRGGWGHPSRGPLLGGGVRYYFGEAAAQGRGTPHSHQPQHSD
HDASNSGMLPRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQ
ESSSGGLLDRELFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVA
AYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAVDMEQKDYDSRTALHVAAAEGHIDVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYHDSYMLSETQAEVAAETLSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgagggctctgcagaacgcgctgagccgcgcgggcagccacggccagagg
ggaggctggggtcacccgagccggggcccgctcctgggcgggggtgtccggtactacttc
ggtgaggccgcggcgcagggcagggggacgccgcacagccaccagccgcagcactcggac
catgatgcctcgaacagtggcatgttgcctcgacttggtgacctgcttttctacaccatt
gcagaggggcaggaacgcatccccatccataagttcaccacggccctgaaggccactgga
ctgcagacgtcagacccacggctccaggactgcatgagcaagatgcagcgcatggtccaa
gagtccagcagtggtggcctcttggaccgagaactcttccaaaagtgtgtgagcagcaac
attgtgctcctgactcaggcattccggaagaagtttgtcattcctgactttgaggagttc
acaggccatgtggatcgtatatttgaggatgccaaagagctcactggaggcaaagtggca
gcctacatccctcacctggccaagtcaaacccagatctttggggcgtctccctgtgcact
gtggatgggcagcgacactctgtgggccacacgaagatccctttctgcctacagtcctgt
gtcaagccactcacttacgccatctccgtgagcaccttaggcaccgactacgtgcacaag
ttcgtgggcaaggaacccagtggtctgcgctataacaaactctccctcaacgaggaagga
atccctcataaccccatggtcaatgctggtgctattgtggtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgactttgtgttacagtatctgaacaagatggctggg
aatgaattcatggggttcagcaatgccacattccagtcagagaaggagactggggatcgg
aattacgccattggctattacctcaaggagaagaagtgcttccctaagggagtggacatg
atggctgcccttgatctctatttccagctgtgctctgtggaggttacctgtgagtcaggc
agtgtcatggcggccactcttgccaatggcggcatctgccccatcacaggggagagcgtg
ctgagtgcggaagccgtgcgcaacaccctcagcctcatgcactcctgtggcatgtatgac
ttctcgggccagtttgccttccacgtgggcctgccagccaagtcagctgtgtcgggagcc
atcctcctggttgtacccaatgtcatggggatgatgtgtctgtcacccccgttagacaag
ctggggaacagccacaggggcatcagcttctgccagaagttggtgtctctgtttaacttc
cacaactacgacaacctgcggcactgtgctcggaagttagacccacggagggaagggggg
gaagttcggaacaagaccgtggtgaacctgttatttgctgcatatagtggagatgtctca
gctcttcgaaggtttgccttgtctgccgtggatatggagcagaaggactatgattcccgc
acagccctacatgtggcggcagcggaaggacacattgacgttgtcaagtttctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggatgatgcc
gtgcagttcaatcacctggaggtggtcaaactgcttcaggattaccatgactcctacatg
ctgtctgagactcaagctgaggtagcagctgagactctgtcaaaagagaacttagagagc
atggtgtga

DBGET integrated database retrieval system