KEGG   Rattus norvegicus (rat): 24172Help
Entry
24172             CDS       T01003                                 

Gene name
Adh1, Adh, Adh1a, Adh1c
Definition
alcohol dehydrogenase 1 (class I) (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rno00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rno00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rno00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:rno00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:rno00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q44
AA seq 376 aa AA seqDB search
MSTAGKVIKCKAAVLWEPHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSGSLFT
PLPAVLGHEGAGIVESIGEGVTCVKPGDKVIPLFSPQCGKCRICKHPESNLCCQTKNLTQ
PKGALLDGTSRFSCRGKPIHHFISTSTFSQYTVVDDIAVAKIDAAAPLDKVCLIGCGFST
GYGSAVQVAKVTPGSTCAVFGLGGVGLSVVIGCKTAGAAKIIAVDINKDKFAKAKELGAT
DCINPQDYTKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHSACGVSVIVGVPPSA
QSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLITHVLPFEKINEA
FDLLRAGKSIRTVLTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagctggaaaagtaatcaaatgcaaagcggccgtgctatgggagcctcacaag
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgcattaag
atggtggccaccggagtctgccgctcagatgatcacgcggttagtggatccctgttcacg
cctcttcctgcagttctaggccacgagggagctggcattgttgagagcattggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcatcccgctgttctctccccagtgtggaaaa
tgcaggatctgcaagcacccggaaagcaacctctgttgccaaactaagaatctgacacag
cctaagggagctttgctcgacggcaccagcaggttctcctgcaggggaaagcccattcac
cacttcatcagcaccagcaccttctcccagtacactgtggtagatgacatagcggtggcc
aaaatcgatgcggctgcaccactggacaaagtctgcctcatcggctgtggcttctcgact
ggctatggctctgccgtccaagtcgccaaggtgaccccaggctccacctgtgccgtgttt
ggcctgggaggtgttggtctgtctgtcgtcattggctgtaaaacagcaggagcagccaag
atcattgccgtggacatcaacaaagacaagtttgcgaaggccaaagagttaggtgccact
gactgtatcaaccctcaagactacaccaaacccatccaggaagttctccaggagatgact
gatggaggggtggacttttcatttgaagtcattggccgtcttgacaccatgacttctgcc
ctgttaagctgccattcagcatgcggtgtaagcgtcattgtcggggtgcctcccagtgcc
caaagcctctccgttaaccccatgtcgctgctgctgggacgcacctggaaaggagcaata
ttcggcgggtttaagagtaaagatgccgtccccaaacttgtcgctgacttcatggctaag
aagtttccgttggagccgctgattactcatgttttaccttttgaaaagataaatgaagca
tttgacctgctccgtgctggaaagagtatccgtaccgtcctgacgttctga

DBGET integrated database retrieval system