KEGG   Rattus norvegicus (rat): 24172Help
Entry
24172             CDS       T01003                                 

Gene name
Adh1, Adh, Adh1a, Adh1c
Definition
alcohol dehydrogenase 1 (class I) (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24172 (Adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    24172 (Adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    24172 (Adh1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24172 (Adh1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24172 (Adh1)
   00982 Drug metabolism - cytochrome P450
    24172 (Adh1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    24172 (Adh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     24172 (Adh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q44
AA seq 376 aa AA seqDB search
MSTAGKVIKCKAAVLWEPHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSGSLFT
PLPAVLGHEGAGIVESIGEGVTCVKPGDKVIPLFSPQCGKCRICKHPESNLCCQTKNLTQ
PKGALLDGTSRFSCRGKPIHHFISTSTFSQYTVVDDIAVAKIDAAAPLDKVCLIGCGFST
GYGSAVQVAKVTPGSTCAVFGLGGVGLSVVIGCKTAGAAKIIAVDINKDKFAKAKELGAT
DCINPQDYTKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHSACGVSVIVGVPPSA
QSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLITHVLPFEKINEA
FDLLRAGKSIRTVLTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagctggaaaagtaatcaaatgcaaagcggccgtgctatgggagcctcacaag
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgcattaag
atggtggccaccggagtctgccgctcagatgatcacgcggttagtggatccctgttcacg
cctcttcctgcagttctaggccacgagggagctggcattgttgagagcattggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcatcccgctgttctctccccagtgtggaaaa
tgcaggatctgcaagcacccggaaagcaacctctgttgccaaactaagaatctgacacag
cctaagggagctttgctcgacggcaccagcaggttctcctgcaggggaaagcccattcac
cacttcatcagcaccagcaccttctcccagtacactgtggtagatgacatagcggtggcc
aaaatcgatgcggctgcaccactggacaaagtctgcctcatcggctgtggcttctcgact
ggctatggctctgccgtccaagtcgccaaggtgaccccaggctccacctgtgccgtgttt
ggcctgggaggtgttggtctgtctgtcgtcattggctgtaaaacagcaggagcagccaag
atcattgccgtggacatcaacaaagacaagtttgcgaaggccaaagagttaggtgccact
gactgtatcaaccctcaagactacaccaaacccatccaggaagttctccaggagatgact
gatggaggggtggacttttcatttgaagtcattggccgtcttgacaccatgacttctgcc
ctgttaagctgccattcagcatgcggtgtaagcgtcattgtcggggtgcctcccagtgcc
caaagcctctccgttaaccccatgtcgctgctgctgggacgcacctggaaaggagcaata
ttcggcgggtttaagagtaaagatgccgtccccaaacttgtcgctgacttcatggctaag
aagtttccgttggagccgctgattactcatgttttaccttttgaaaagataaatgaagca
tttgacctgctccgtgctggaaagagtatccgtaccgtcctgacgttctga

DBGET integrated database retrieval system