KEGG   Rattus norvegicus (rat): 24174Help
Entry
24174             CDS       T01003                                 

Gene name
Adra2b
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:rno04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
3q36
AA seq 453 aa AA seqDB search
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA
AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS
RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILA
SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVP
TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAE
EGDEEDEEEVEECEPQTLPASPASVCNPPLQQPQTSRVLATLRGQVLLGKNVGVASGQWW
RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC
NSSLNPVIYTVFNQDFRRAFRRILCRPWTQTGW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccccaccatggaccatcaggagccctactcggtgcaggccaccgccgccatc
gcgtcggccatcacctttctcatccttttcaccattttcggcaatgcgctggtcattctg
gctgtgttgaccagccgctcactccgtgcaccacaaaacctgttcctggtgtcactggca
gcagccgacatcctagtggctactctcatcatccctttctctctggccaacgagctgctg
ggctactggtacttctggcgtgcgtggtgcgaggtctacctggcgctagacgtgctcttc
tgtacctcctccatcgtgcacctgtgtgccatcagcctggacaggtactgggcagtgagc
cgagcattggagtacaactccaagcgcactccgcgccgcatcaagtgcatcatcctcact
gtgtggctcattgcagctgtcatttctctaccgcccctcatctacaagggcgaccaacgc
cccgagccccgcgggctcccccagtgtgagctcaaccaggaggcctggtacatcttggct
tccagcatcggatctttttttgctccctgcctcatcatgatcctcgtctacctgcgaatc
tacgtgattgccaaacgcagccactgcagaggtctcggagccaagaggggctctggagaa
ggtgagtccaagaagccccagccggttgctgggggagtgccaacctcagctaaggtgccc
accctggtctctcctctatcttctgttggagaggccaatggacaccccaagcctccaaga
gagaaggaggagggggagacccctgaagatcctgaggccagggctttgcccccaacttgg
tctgcccttcccagatcaggccaaggccagaagaaggggactagtggggcgactgcagag
gagggagatgaagaggatgaggaagaggtggaagaatgtgaaccccaaacactgccagca
tctcctgcctcggtatgcaacccacccttgcagcagcctcagacttctcgggtactggcc
acacttcgtggccaggtgcttctgggcaagaatgtgggagttgccagtgggcagtggtgg
cgcagacggacacagctgagccgggagaagaggttcacctttgtgctggccgtggtcatt
ggagttttcgtggtctgctggtttcctttcttcttcagctacagcctgggggccatctgc
ccacagcactgcaaggtaccgcatggcctcttccagttcttcttctggatcggctactgc
aacagctctttgaaccctgtcatctacaccgtcttcaaccaggacttccgccgtgccttt
cgaaggatcctttgccggccgtggacccagactggctggtga

DBGET integrated database retrieval system