KEGG   Rattus norvegicus (rat): 24215Help
Entry
24215             CDS       T01003                                 

Gene name
Atp2b2, PMCA2
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 2
  KO
K05850  
Ca2+ transporting ATPase, plasma membrane [EC:3.6.3.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Aldosterone synthesis and secretion
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    24215 (Atp2b2)
   04024 cAMP signaling pathway
    24215 (Atp2b2)
   04022 cGMP - PKG signaling pathway
    24215 (Atp2b2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    24215 (Atp2b2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24215 (Atp2b2)
  Digestive system
   04970 Salivary secretion
    24215 (Atp2b2)
   04972 Pancreatic secretion
    24215 (Atp2b2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     24215 (Atp2b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q42
AA seq 1198 aa AA seqDB search
MGDMTNSDFYSKNQRNESSHGGEFGCSMEELRSLMELRGTEAVVKIKETYGDTESICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEP
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcagcatggaggagctgcgctccctcatggagctgcggggcact
gaggctgtggtcaagatcaaggagacatatggggacactgaatccatctgccggcgcctc
aaaacctctcctgttgaaggtttgccaggcaccgctccagacctggaaaagaggaaacag
attttcgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcactacaggacgtgacgctcatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccacccggagagagcaatgaaggatgtgccacggcccaaggtggg
gcagaagatgaaggtgaagcagaagcaggctggatcgagggggctgccatcctgctgtca
gtcatctgtgtggtcctcgtcacagccttcaatgattggagtaaagagaaacagttccgg
ggcctgcagagccgaattgagcaggaacagaagttcaccgtagtccgggctggccaggtg
gtccagatccctgtggccgagattgtggttggggacattgcccagatcaaatacggtgac
ctccttcctgctgatggcctcttcatccagggcaatgacctcaagatcgatgaaagctcg
ctcacaggggagtctgaccaggtgcgcaagtctgtggataaggaccctatgttgctgtca
ggaactcatgtgatggaaggctcaggacggatggtggtgactgctgtgggtgtcaactct
caaactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgctatggaaatgcagcctctgaagagtgcg
gagggcggtgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaagctggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacggtgatcatcctggtgctctacttcaccgtggacaccttcgtggtcaacaag
aagccgtggctgacggagtgcacaccggtctacgtgcagtacttcgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattccgtgaagaaaatgatgaaggacaacaacctggtccgtcacctggac
gcctgtgagaccatgggtaacgccacagccatctgctcagacaagacaggcacgctgacc
accaaccgcatgaccgtggtgcaggcctatgtcggtgatgtccactacaaggagatccct
gatcccagctccatcaatgccaagacattggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatcctccccccagaaaaagagggcgccctgccccggcaggtg
ggcaacaagacagagtgtggcctgctgggcttcgtgctggacctgaggcaggattacgag
ccggtacgcagccagatgccagaggaaaagctgtataaggtgtacaccttcaactctgtg
cgcaagtccatgagcaccgtcatcaagatgcctgacgagagcttccgcatgtacagcaaa
ggtgcttcggagattgtgctcaaaaagtgctgcaagattctcagtggggcaggggagccc
cgtgtcttccggccccgtgacagggatgagatggttaagaaggtgatcgagcccatggcc
tgtgacgggctccgtaccatctgtgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacctgcatctgcgtggtgggcatc
gaagacccagtgcgacctgaggtcccagaagccatccgcaagtgccagcgggccggtatc
acagtccgcatggtcaccggtgacaacatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
atccgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgatcctcgcccacggataagcacaccctggtcaaaggcatcatcgac
agcacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgatggg
cctgctctcaagaaggcagatgtgggcttcgcgatgggcatcgcaggcacggatgtggcc
aaggaggcctcagacatcatcctgacagacgacaacttcagcagcatcgttaaggcagtg
atgtggggccgtaatgtctatgacagcatatccaaattcctgcagtttcagctgactgtc
aatgtggtggctgtgatcgtggccttcacgggtgcctgcattacacaggactcccctctc
aaggcggtgcagatgctctgggtgaacctcatcatggacacatttgcttccctggccctg
gcaacagagccacccaccgagactctgctcctgaggaaaccttacggccgcaacaagccg
ctcatctcgagaaccatgatgaagaacatcctgggccacgccgtctaccagctaaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagattgacagcggaaggaacgcc
ccgctgcactcgccaccctcggagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgtaagatccacggcgagcgtaacgtcttcgacgga
atcttccggaaccccatcttctgcaccatcgttctcggcacttttgccatccagatagtg
attgtgcagttcggcggcaaacccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcattgccaccatccct
accagcaggctcaagtttctgaaagaggcagggcggctaacacagaaggaggagatcccc
gaggaagagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccga
ggccagatcctatggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

DBGET integrated database retrieval system