KEGG   Rattus norvegicus (rat): 24225Help
Entry
24225             CDS       T01003                                 

Gene name
Bdnf
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    24225 (Bdnf)
   04024 cAMP signaling pathway
    24225 (Bdnf)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    24225 (Bdnf)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    24225 (Bdnf)
  Substance dependence
   05030 Cocaine addiction
    24225 (Bdnf)
   05034 Alcoholism
    24225 (Bdnf)
Cytokines [BR:rno04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    24225 (Bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
3q33
AA seq 362 aa AA seqDB search
MSDPSAWRWLSSGCPPLPPRRGAPAGWLSHGPHCARDSPAWRRKPPGAARHLRLAGFDET
GFPQLATAALGQTRKRTGPRAGRRDQERDNNVTPLPGIRELCVDPEFHQVRRVMTILFLT
MVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEH
VIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMR
VRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETK
CNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccccagtgcctggcgctggctgagctctgggtgcccgccgctgccgccgcgc
cggggcgcacccgctggctggctgtcgcacggtccccattgcgcccgggactccccggct
tggagaaggaaaccgcctggggcggcgcgccacctccgcctggcaggctttgatgagacc
gggttccctcagctcgccaccgctgctttggggcagacgagaaagcgcacggggcccagg
gcagggcgcagggaccaggagcgtgacaacaatgtgactccactgccggggatccgagag
ctttgtgtggaccctgagttccaccaggtgagaagagtgatgaccatccttttccttact
atggttatttcatacttcggttgcatgaaggctgcgcccatgaaagaagcaaacgtccac
ggacaaggcaacttggcctacccagctgtgcggacccatgggactctggagagcgtgaat
gggcccagggcaggttcgagaggtctgacgacgacgtccctggctgacacttttgagcac
gtgatcgaagagctgctggatgaggaccagaaggttcggcccaacgaagaaaaccataag
gacgcggacttgtacacttcccgggtgatgctcagcagtcaagtgcctttggagcctcct
ctgctctttctgctggaggaatacaaaaattacctggatgccgcaaacatgtctatgagg
gttcggcgccactccgaccccgcccgccgtggggagctgagcgtgtgtgacagtattagc
gagtgggtcacagcggcagataaaaagactgcagtggacatgtccggtgggacggtcaca
gtcctggagaaagtcccggtatcaaaaggccaactgaagcaatatttctacgagaccaag
tgtaatcccatgggttacacgaaggaaggctgcaggggcatagacaaaaggcactggaac
tcgcaatgccgaactacccaatcgtatgttcgggcccttactatggatagcaaaaagaga
attggctggcggttcataaggatagacacttcctgtgtatgtacactgaccattaaaagg
ggaagatag

DBGET integrated database retrieval system