KEGG   Rattus norvegicus (rat): 24225Help
Entry
24225             CDS       T01003                                 

Gene name
Bdnf
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:rno04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:rno05030]
Human Diseases; Substance dependence; Alcoholism [PATH:rno05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
3q33
AA seq 362 aa AA seqDB search
MSDPSAWRWLSSGCPPLPPRRGAPAGWLSHGPHCARDSPAWRRKPPGAARHLRLAGFDET
GFPQLATAALGQTRKRTGPRAGRRDQERDNNVTPLPGIRELCVDPEFHQVRRVMTILFLT
MVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEH
VIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMR
VRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETK
CNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccccagtgcctggcgctggctgagctctgggtgcccgccgctgccgccgcgc
cggggcgcacccgctggctggctgtcgcacggtccccattgcgcccgggactccccggct
tggagaaggaaaccgcctggggcggcgcgccacctccgcctggcaggctttgatgagacc
gggttccctcagctcgccaccgctgctttggggcagacgagaaagcgcacggggcccagg
gcagggcgcagggaccaggagcgtgacaacaatgtgactccactgccggggatccgagag
ctttgtgtggaccctgagttccaccaggtgagaagagtgatgaccatccttttccttact
atggttatttcatacttcggttgcatgaaggctgcgcccatgaaagaagcaaacgtccac
ggacaaggcaacttggcctacccagctgtgcggacccatgggactctggagagcgtgaat
gggcccagggcaggttcgagaggtctgacgacgacgtccctggctgacacttttgagcac
gtgatcgaagagctgctggatgaggaccagaaggttcggcccaacgaagaaaaccataag
gacgcggacttgtacacttcccgggtgatgctcagcagtcaagtgcctttggagcctcct
ctgctctttctgctggaggaatacaaaaattacctggatgccgcaaacatgtctatgagg
gttcggcgccactccgaccccgcccgccgtggggagctgagcgtgtgtgacagtattagc
gagtgggtcacagcggcagataaaaagactgcagtggacatgtccggtgggacggtcaca
gtcctggagaaagtcccggtatcaaaaggccaactgaagcaatatttctacgagaccaag
tgtaatcccatgggttacacgaaggaaggctgcaggggcatagacaaaaggcactggaac
tcgcaatgccgaactacccaatcgtatgttcgggcccttactatggatagcaaaaagaga
attggctggcggttcataaggatagacacttcctgtgtatgtacactgaccattaaaagg
ggaagatag

DBGET integrated database retrieval system