KEGG   Rattus norvegicus (rat): 24247Help
Entry
24247             CDS       T01003                                 

Gene name
Casr, PCaR1
Definition
(RefSeq) calcium-sensing receptor
  KO
K04612  
calcium-sensing receptor
Organism
rno  Rattus norvegicus (rat)
Brite
G protein-coupled receptors [BR:rno04030]
 Class C. Metabotropic glutamate receptor family
  Calcium-sensing
   Extracellular calcium-sensing
    24247 (Casr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
11q22
AA seq 1079 aa AA seqDB search
MASYSCCLALLALAWHSSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPSLLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQY
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIWLASEAWA
SSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFVRSHEEGGNRLLNSSTAFRPLCTGDENINSVETPYMDYEHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCQAGTRKGIIEGEPTCCFECVECPDGEYSGETDASACDKCPDDFWSNENHTSCIA
KEIEFLAWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQILICIIWLYTAPPSSYRNHELEDEIIFITCHEGSLMALGSLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRSSTAAHAFKVAARATLRRPNISRKRSS
SLGGSTGSIPSSSISSKSNSEDRFPQPERQKQQQPLSLTQQEQQQQPLTLHPQQQQQPQQ
PRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSMRQNSLEAQRSNDTLGRHQALLPLQCA
DADSEMTIQETGLQGPMVGDHQPEMESSDEMSPALVMSTSRSFVISGGGSSVTENVLHS
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtacagctgctgtttggccctcttggctcttgcctggcactcctctgcctat
gggcctgaccagcgagcccaaaagaagggggacattatcctaggaggtctctttcctatc
cattttggagtagcagccaaagatcaagatctgaagtcaagaccagagtctgtggagtgc
attaggtataacttccgtggattccgatggttacaagccatgatattcgccatagaggag
ataaacagcagcccctcccttcttcccaacatgacactgggatataggatatttgacacc
tgtaacaccgtctccaaggcgctggaagccaccttgagttttgttgcccagaacaaaatc
gattctttgaacctggacgagttctgcaactgctctgagcacatcccttcgaccattgcc
gtggtgggagccaccggctccggtgtctccacggcggtagccaacctgctgggacttttc
tacatcccccaggtgagctacgcctcctccagcaggctcctcagcaataagaaccagtac
aaatccttcctccgcaccattcccaatgacgaacaccaggcaaccgcgatggccgacatc
atcgagtacttccgctggaactgggtgggcacaattgcagctgatgacgactatggcaga
cctggcattgagaagttccgagaggaagccgaagagagggatatctgcattgattttagc
gagctcatctcccagtactctgacgaggaagagatccagcaggtggtcgaagtgatccaa
aactctacggccaaggtcattgtcgttttctccagcggcccggacctagaacctctcatc
aaggagattgtgcggcgtaacatcacaggcaggatctggctggctagcgaggcctgggcc
agttcctcgctgattgctatgcctgagtatttccatgtagtcgggggcaccattgggttc
ggtctgaaggctgggcagattccaggcttccgagaattcctacagaaagttcatcctagg
aagtctgtccacaatggttttgccaaagagttttgggaagaaacttttaattgccacctc
caagaaggcgcaaaaggacctttacctgtggacaccttcgtgagaagtcacgaagaaggt
ggcaacaggttactcaatagctctactgccttccgacccctctgcacaggggatgagaac
atcaacagtgtggagaccccttacatggattacgaacatttacggatatcctacaatgtg
tacttagccgtctactccattgcgcatgccctacaagatatatacacctgcttacccgga
agagggcttttcaccaacgggtcctgtgcagacatcaagaaggttgaggcctggcaggtc
ttgaagcacctacggcacctgaacttcaccaacaacatgggggagcaggtgaccttcgat
gagtgtggtgatctggtggggaactattctatcatcaactggcacctctccccagaggac
ggctccattgtgttcaaggaagttgggtactacaatgtgtatgccaagaagggagaaaga
ctcttcatcaatgaggagaagatcttgtggagtgggttctccagagaggtgcctttctcc
aattgcagccgggactgtcaggcagggaccaggaaggggatcatcgagggagagcccacc
tgctgctttgagtgtgtggagtgtcctgatggagagtacagtggagagacagatgcgagt
gcctgtgacaagtgcccggatgacttctggtccaatgagaaccacacttcttgcattgcc
aaggagattgagtttctggcgtggaccgagccctttggaatcgctctcactctctttgcg
gtgctgggcattttcctgaccgcctttgtgctgggtgtcttcatcaagttccgaaacaca
cctatcgtcaaggccaccaaccgagaactgtcctacctcctgctcttctccctactctgc
tgcttctccagctccttgttcttcattggggagccccaggactggacgtgccgcctgcga
cagcctgctttcggcatcagctttgtgctctgtatctcgtgcatcttggtgaagaccaat
cgcgtcctcctggtatttgaagccaagatacccaccagcttccaccggaagtggtggggg
ctcaacctgcagttcctgctggttttcctctgcaccttcatgcagatcctcatctgcatc
atctggctctacacggcgcccccctctagctaccgcaaccatgagctggaagacgaaatc
atcttcatcacgtgccatgagggctcactcatggcacttggctccctgatcggctatacc
tgcctgctggctgccatctgcttcttctttgccttcaagtccaggaagttaccagagaac
ttcaacgaagccaagttcattaccttcagcatgctcatcttcttcatcgtctggatctcc
ttcattccagcctatgccagcacctacggcaagtttgtctctgccgtagaggtgatcgcc
attttggcagccagctttggcttactagcctgcatcttcttcaacaaggtctacattatc
ctcttcaagccttcccggaacaccattgaggaagtccgctccagcaccgcagcacatgct
ttcaaagtagcagcccgcgccactctacgccgtcccaacatctcccggaagcggtccagc
agccttggaggctccaccggctccattccctcctcctccatcagcagcaaaagcaacagc
gaagaccggttcccgcagccagagaggcagaagcaacagcaaccgctgtccctgacccag
caagaacagcagcagcagcccctgaccctccacccacagcaacagcagcagccacagcag
ccgagatgcaaacagaaggtcatcttcggcagtggtacggtcaccttctctctgagtttt
gacgagcctcagaagaatgccatggcccacaggaactccatgcgtcagaactccctggag
gcccagaggagcaacgacaccttgggcagacaccaggccctgcttcccctacagtgtgca
gatgcggactcagaaatgaccattcaggaaacgggcctgcaagggcccatggtgggggac
caccagccagaaatggaaagctcagatgaaatgtccccagcgctggtcatgtccacctct
cggagcttcgtcattagtggtggaggtagctctgtgacggaaaacgtattacactcctaa

DBGET integrated database retrieval system