KEGG   Rattus norvegicus (rat): 24253Help
Entry
24253             CDS       T01003                                 

Gene name
Cebpb, Il6dbp, NF-IL6, TCF5
Definition
(RefSeq) CCAAT/enhancer binding protein beta
  KO
K10048  
CCAAT/enhancer binding protein (C/EBP), beta
Organism
rno  Rattus norvegicus (rat)
Pathway
TNF signaling pathway
Tuberculosis
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    24253 (Cebpb)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    24253 (Cebpb)
  Infectious diseases
   05152 Tuberculosis
    24253 (Cebpb)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    24253 (Cebpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 297 aa AA seqDB search
MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
IDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAA
PPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLST
SSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKS
RDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcctgctggcctgggacgcagcatgcctcccgccgccgcccgccgcctttaga
cccatggaagtggccaacttctactacgagcccgactgcctggcctacggggccaaggcg
gcccgcgccgcgccgcgcgcccccgccgccgagccggccatcggcgagcacgagcgcgcc
atcgacttcagcccctacctggagccgctcgcgcccgccgccgcggacttcgccgcgccc
gcgcccgcgcaccacgacttcctttccgacctcttcgccgacgactacggcgccaagccg
agcaagaagccgtccgactacggttacgtgagcctcggccgcgcgggcgccaaggccgca
ccgcccgcctgcttcccgccgccgcctcccgccgcactcaaggccgagccgggcttcgaa
cccgcggactgcaagcgcgcggacgacgcgcccgccatggcggccggcttcccgttcgcc
ctgcgcgcctacctgggctaccaggcgacgccgagcggcagcagcggcagcctgtccacg
tcgtcgtcgtccagcccgcccgggacgccgagccccgccgacgccaaggccgcgcccgcc
gcctgcttcgcggggccgccggccgcgcccgccaaggccaaggccaagaaggcggtggac
aagctgagcgacgagtacaagatgcggcgcgagcgcaacaacatcgcggtgcgcaagagc
cgcgacaaggccaagatgcgcaacctggagacgcagcacaaggtgctggagctgacggcg
gagaacgagcggctgcagaagaaggtggagcagctgtcgcgagagctcagcacgctgcgg
aacttgttcaagcagctgcccgagccgctgctggcctcggcgggtcactgctag

DBGET integrated database retrieval system