KEGG   Rattus norvegicus (rat): 24267Help
Entry
24267             CDS       T01003                                 

Gene name
Comt
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24267 (Comt)
  Amino acid metabolism
   00350 Tyrosine metabolism
    24267 (Comt)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    24267 (Comt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     24267 (Comt)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   24267 (Comt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 264 aa AA seqDB search
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNA
KPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMA
RLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAIYQGPSSPDKS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggctgcagtctcattgggtctcctgttgttggccctcctcctgctcttgcga
cacctgggctggggcttggtgactattttctggtttgagtacgtgctgcagccagtccac
aacctgatcatgggtgacacaaaggagcagcgcatcctgcgctacgtgcagcagaatgca
aagcctggagaccctcagagcgtcctggaggccatcgacacctactgcacacagaaggaa
tgggccatgaatgtgggtgacgcgaaaggccaaatcatggatgcagtgattcgggagtac
agcccctccctggtgctggagctgggagcttactgtggctactcagcagtgcgaatggct
cgcctgctgcagcctggagccaggcttctcaccatggagatgaaccctgactacgctgcc
atcacccagcaaatgctgaactttgcaggcctacaggacaaagtcaccatcctcaatggg
gcatcccaggatcttatcccccagctgaagaagaagtacgacgtggacacactagacatg
gtctttcttgaccactggaaagaccgctaccttccagacacacttctcctggagaaatgt
ggcctgctgcgcaaggggacagtgctcctagctgacaacgtcatcgtcccgggaacccct
gacttcctggcgtatgtgagagggagcagcagcttcgagtgcacacactacagctcatac
ctggagtacatgaaagttgtagacggcttggagaaggcaatctaccagggtccaagtagc
cctgacaagtcttga

DBGET integrated database retrieval system