KEGG   Rattus norvegicus (rat): 24269Help
Entry
24269             CDS       T01003                                 

Gene name
Cpa1
Definition
carboxypeptidase A1 (pancreatic) (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:rno04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:rno04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q22
AA seq 419 aa AA seqDB search
MKRLLILSLLLEAVCGNENFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRDAARAG
IPIDVRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEKQQMSAFQARALSTDSFNYA
TYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHS
REWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTR
SHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIK
AFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQA
SGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagagactactgattctgagtctgctgctggaagcagtctgtggcaatgagaacttt
gtgggacaccaggttctccgaatctctgcagccgatgaagcccaggtgcagaaagtgaag
gagttggaggacctggagcacttgcagttggacttctggcgggacgctgcccgggccggt
atccccattgatgtcagagtgcccttccccagcatccaatctgtgaaagcattcttggaa
tatcatggtattagctatgagatcatgattgaagatgtgcagttactgctcgatgaggag
aaacagcagatgtctgccttccaggccagggccttgtccactgactctttcaattatgcc
acctatcatacgctggatgagatctacgaattcatggacctgctggtggctgagcaccca
cagcttgtgagcaagatccagatcggcaacacctttgaaggtcgccccatccatgtgctg
aagttcagcactggagggaccaatcgcccagcaatctggatcgacactggcatccattct
agggagtgggtcacccaggctagtggggtctggtttgcaaagaagatcaccaaagactat
ggccaggaccccaccttcacagccgttcttgacaacatggacatcttcctggagattgtc
accaaccctgatggttttgcctacacccacaaaacgaatcgcatgtggcgcaagactcga
tcacacacccagggctccctctgtgttggtgtggaccccaacaggaactgggacgctggc
tttgggatggccggagcaagtagcaacccctgctcggaaacttaccgaggcaaatttccc
aactctgaggtggaggtcaagtccatcgtggactttgtgacgagccatgggaacatcaag
gccttcatctccatccacagctattcccagctcctgctctacccctacggctacacgtcg
gaaccagcccctgaccaggcagagctggatcagctagctaagtctgctgtgacagccttg
acgtctctacacgggaccaagttcaagtatggcagcatcatcgatacaatctatcaagcc
agtgggagcactatcgattggacctacagccagggcatcaagtactctttcacttttgaa
ctgagggacactgggcttagaggattcctgctgcctgcctcccagatcatccctacggcg
gaggagacatggctggcccttttgaccatcatggaccacacagtcaaacacccctactga

DBGET integrated database retrieval system