KEGG   Rattus norvegicus (rat): 24271Help
Entry
24271             CDS       T01003                                 

Gene name
Cpb1, Cpb
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    24271 (Cpb1)
   04974 Protein digestion and absorption
    24271 (Cpb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     24271 (Cpb1)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   24271 (Cpb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q24
AA seq 415 aa AA seqDB search
MLLLLALVSVALAHASEEHFDGNRVYRVSVHGEDHVNLIQELANTKEIDFWKPDSATQVK
PLTTVDFHVKAEDVADVENFLEENEVHYEVLISNVRNALESQFDSHTRASGHSYTKYNKW
ETIEAWIQQVATDNPDLVTQSVIGTTFEGRNMYVLKIGKTRPNKPAIFIDCGFHAREWIS
PAFCQWFVREAVRTYNQEIHMKQLLDELDFYVLPVVNIDGYVYTWTKDRMWRKTRSTMAG
SSCLGVRPNRNFNAGWCEVGASRSPCSETYCGPAPESEKETKALADFIRNNLSTIKAYLT
IHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKELATLHGTKYTYGPGATTIYPAAGGS
DDWSYDQGIKYSFTFELRDTGFFGFLLPESQIRQTCEETMLAVKYIANYVREHLY
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctactggccctggtgagtgtggccttggctcatgcttccgaggagcacttt
gatggcaaccgggtgtaccgtgtcagtgtacatggtgaagatcacgtcaacttaattcag
gagctagccaacaccaaagagattgatttctggaaaccagattctgctacacaagtgaag
cctctcactacagttgactttcatgttaaagcagaagatgttgctgatgtggagaacttt
ctggaggagaatgaagttcactatgaggtactgataagcaacgtgagaaatgctctggaa
tcccagtttgatagccacacccgtgcaagtggacacagctacaccaagtacaacaagtgg
gaaacgattgaggcgtggattcaacaagttgccactgataatccagaccttgtcactcag
agcgtcattggaaccacatttgaaggacgtaacatgtatgtcctcaagattggcaaaact
agaccgaataagcctgccatcttcatcgattgtggtttccatgcaagagagtggatttct
cctgcattctgtcagtggtttgtgagagaggctgtccgtacctataatcaagagatccac
atgaaacagcttctagatgaactggatttctatgttctgcctgtggtcaacattgatggc
tatgtctacacctggactaaggacagaatgtggagaaaaacccgctctactatggctgga
agttcctgcttgggtgtaagacccaacaggaattttaatgctggctggtgtgaagtggga
gcttctcggagtccctgctctgaaacttactgtggaccagccccagagtctgaaaaagag
acaaaggccctggcagatttcatccgcaacaacctctccaccatcaaggcctacctgacc
atccactcatactcacagatgatgctctacccttactcctatgactacaaactgcctgag
aactatgaggaattgaatgccctggtgaaaggtgcggcaaaggagcttgccactctgcat
ggcaccaagtacacatatggcccaggagctacaacaatctatcctgctgctgggggatct
gacgactggtcttatgatcagggaatcaaatattcatttacctttgaactccgggataca
ggcttctttggctttctccttcctgagtctcagatccgccagacctgtgaggagacaatg
cttgcagtcaagtacattgccaattatgtccgagaacatctatattag

DBGET integrated database retrieval system