KEGG   Rattus norvegicus (rat): 24291Help
Entry
24291             CDS       T01003                                 

Gene name
Ctrb1, Ctrb
Definition
chymotrypsinogen B1 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:rno04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:rno04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 263 aa AA seqDB search
MAFLWLVSCFALVGATFGCGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRND
ITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPI
VSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCST
STPAVYSRVTALMPWVQQILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctttggctcgtgtcctgctttgcccttgtgggggccacctttggctgtgga
gtccctaccatccaacccgtgctgactggcctgtccaggatcgtcaacggagaggatgct
attcccggctcctggccctggcaggtgtcgctgcaggataaaactggcttccatttctgc
gggggctccctcatcagcgaggactgggtggtcactgctgcccactgcggggtcaagacc
tccgacgtggtggtagctggagagtttgaccagggctccgacgaagagaacatccaggtc
ctgaagatcgcacaggtctttaagaaccccaagttcaatatgttcactgtgcgcaatgac
atcactctgctgaagctggccactcctgcccagttctctgagactgtgtctgccgtgtgt
ctacccaacgtcgatgatgacttccctcctggcactgtgtgcgccaccactggctggggc
aagaccaaatacaatgccctcaagacccctgagaagctgcagcaggccgccctgcccatc
gtgtccgaggctgactgcaagaagtcctggggttccaagatcaccgatgtgatgacctgc
gcaggcgctagcggcgtctcttcctgcatgggtgactccggtggccccctcgtctgccag
aaagatggagtctggaccctggcaggcattgtgtcctggggcagtggcgtctgttccact
tccactcctgctgtgtattcccgagtcacagccctcatgccctgggttcagcagatcttg
gaagccaactga

DBGET integrated database retrieval system