KEGG   Rattus norvegicus (rat): 24291Help
Entry
24291             CDS       T01003                                 

Gene name
Ctrb1, Ctrb
Definition
chymotrypsinogen B1 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    24291 (Ctrb1)
   04974 Protein digestion and absorption
    24291 (Ctrb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     24291 (Ctrb1)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   24291 (Ctrb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 263 aa AA seqDB search
MAFLWLVSCFALVGATFGCGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRND
ITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPI
VSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCST
STPAVYSRVTALMPWVQQILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctttggctcgtgtcctgctttgcccttgtgggggccacctttggctgtgga
gtccctaccatccaacccgtgctgactggcctgtccaggatcgtcaacggagaggatgct
attcccggctcctggccctggcaggtgtcgctgcaggataaaactggcttccatttctgc
gggggctccctcatcagcgaggactgggtggtcactgctgcccactgcggggtcaagacc
tccgacgtggtggtagctggagagtttgaccagggctccgacgaagagaacatccaggtc
ctgaagatcgcacaggtctttaagaaccccaagttcaatatgttcactgtgcgcaatgac
atcactctgctgaagctggccactcctgcccagttctctgagactgtgtctgccgtgtgt
ctacccaacgtcgatgatgacttccctcctggcactgtgtgcgccaccactggctggggc
aagaccaaatacaatgccctcaagacccctgagaagctgcagcaggccgccctgcccatc
gtgtccgaggctgactgcaagaagtcctggggttccaagatcaccgatgtgatgacctgc
gcaggcgctagcggcgtctcttcctgcatgggtgactccggtggccccctcgtctgccag
aaagatggagtctggaccctggcaggcattgtgtcctggggcagtggcgtctgttccact
tccactcctgctgtgtattcccgagtcacagccctcatgccctgggttcagcagatcttg
gaagccaactga

DBGET integrated database retrieval system