KEGG   Rattus norvegicus (rat): 24296Help
Entry
24296             CDS       T01003                                 

Gene name
Cyp1a1, AHH, AHRR, CP11, CYP1, Cyp45c, Cypc45c, P-450MC, P1-450, P450-C, P450DX
Definition
cytochrome P450, family 1, subfamily a, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24296 (Cyp1a1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    24296 (Cyp1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24296 (Cyp1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24296 (Cyp1a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    24296 (Cyp1a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    24296 (Cyp1a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24296 (Cyp1a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP1 family
   24296 (Cyp1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q24
AA seq 524 aa AA seqDB search
MPSVYGFPAFTSATELLLAVTTFCLGFWVVRVTRTWVPKGLKSPPGPWGLPFMGHVLTLG
KNPHLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLIA
NGQSMTFNPDSGPLWAARRRLAQNALKSFSIASDPTLASSCYLEEHVSKEAEYLISKFQK
LMAEVGHFDPFKYLVVSVANVICAICFGRRYDHDDQELLSIVNLSNEFGEVTGSGYPADF
IPILRYLPNSSLDAFKDLNKKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRRLDE
NANVQLSDDKVITIVFDLFGAGFDTITTAISWSLMYLVTNPRIQRKIQEELDTVIGRDRQ
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTIRDTSLNGFYIPKGHCVFVNQWQVNH
DQELWGDPNEFRPERFLTSSGTLDKHLSEKVILFGLGKRKCIGETIGRLEVFLFLAILLQ
QMEFNVSPGEKVDMTPAYGLTLKHARCEHFQVQMRSSGPQHLQA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgtgtatggattcccagccttcacatcagccacagagctgctcttggccgtc
accacattctgccttggattctgggtggttagagtcacaagaacctgggttcccaaaggt
ctgaagagtccacccggaccctggggcttgcccttcatggggcacgtgctgaccctgggg
aagaacccacacctgtcactgacaaaactgagtcagcagtatggggacgtgctgcagatc
cgtattggctccacacccgtggtggtgctgagcggcctgaacaccatcaagcaggccctg
gtgaaacagggggatgacttcaaaggccggccagacctctacagcttcacacttatcgct
aatggccagagcatgactttcaacccagactctggaccgctgtgggctgcccgccggcgc
ctggcccagaatgcgctgaagagtttctccatagcctcagacccaacactggcatcctct
tgctacttggaagagcacgtgagcaaagaggctgaatacttaatcagcaagttccagaag
ctgatggcagaggttggccacttcgaccctttcaagtatttggtggtgtcagtggccaat
gtcatctgtgccatatgctttggcagacgttatgaccacgatgaccaagagctgctcagc
atagtcaatctaagcaatgagtttggggaggttactggttctggatacccagctgacttc
attcctatcctccgttacctccctaactcttccctggatgccttcaaggacttgaataag
aagttctacagtttcatgaagaagctaatcaaagagcactacaggacatttgagaagggc
cacatccgggacatcacagacagcctcattgagcattgtcaggacaggaggctggacgag
aatgccaatgtccagctctcagatgataaggtcattacgattgtttttgacctctttgga
gctgggtttgacacaatcacaactgctatctcttggagcctcatgtacctggtaaccaac
cctaggatacagagaaagatccaggaggagttagacacagtgattggcagggatcggcag
ccccggctttctgacagacctcagctgccctatctggaggccttcatcctggagaccttc
cgacattcatcctttgtcccattcaccatcccccacagcaccataagagatacaagtctg
aatggcttctatatccccaagggacactgtgtctttgtgaaccagtggcaggttaaccat
gaccaggaactatggggtgatccaaacgagttccggcctgaaaggtttcttacctccagt
ggcactctggacaaacacctgagtgagaaggtcattctctttggtttgggcaagcgaaag
tgcattggggagaccattggccgactggaggtctttctcttcctggccatcctgctgcag
caaatggaatttaatgtgtcaccaggcgagaaggtggatatgactcctgcctatgggctg
actttaaaacatgcccgctgtgagcacttccaagtgcagatgcggtcttctggtcctcag
catctccaggcttag

DBGET integrated database retrieval system