KEGG   Rattus norvegicus (rat): 24297Help
Entry
24297             CDS       T01003                                 

Gene name
Cyp1a2, CYPD45, P-450d, RATCYPD45
Definition
cytochrome P450, family 1, subfamily a, polypeptide 2 (EC:1.14.14.1)
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rno00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:rno00232]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:rno00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:rno00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q24
AA seq 513 aa AA seqDB search
MAFSQYISLAPELLLATAIFCLVFWVLRGTRTQVPKGLKSPPGPWGLPFIGHMLTLGKNP
HLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLITNGK
SMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSVSSCYLEEHVSKEANHLISKFQKLMA
EVGHFEPVNQVVESVANVIGAMCFGKNFPRKSEEMLNLVKSSKDFVENVTSGNAVDFFPV
LRYLPNPALKRFKNFNDNFVLFLQKTVQEHYQDFNKNSIQDITGALFKHSENYKDNGGLI
PQEKIVNIVNDIFGAGFETVTTAIFWSILLLVTEPKVQRKIHEELDTVIGRDRQPRLSDR
PQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKECCIFINQWQVNHDEKQWK
DPFVFRPERFLTNDNTAIDKTLSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLHQLEFT
VPPGVKVDLTPSYGLTMKPRTCEHVQAWPRFSK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcccagtatatctccttagccccagagctgctactggccactgccatcttc
tgtttagtgttctgggtgttgagaggcacaaggacccaggttcccaaaggtctgaagagt
cctcccggaccctggggcttgcccttcattgggcacatgctgaccctggggaagaaccca
cacctatctctgacaaagctgagtcagcagtatggggacgtgctgcagatccgcattggc
tccacacccgtggtggtgctgagcggcctgaacaccatcaagcaggccctagtgaagcag
ggggatgacttcaaaggccggccagacctctacagcttcacacttatcactaatggcaag
agcatgactttcaacccagactctggaccggtctgggctgcccgccggcgcctggcccag
gatgccctgaagagtttctccatagcctcagaccccacatcagtatcctcttgctacttg
gaggagcacgtgagcaaagaggctaaccatctaatcagcaagttccagaagctgatggca
gaggttggccacttcgaaccagtcaaccaggtggtggaatcggtggctaatgtcatcgga
gccatgtgttttgggaagaacttccccaggaagagcgaggagatgctcaacctcgtgaag
agcagcaaggactttgtggagaatgtcacctcagggaatgctgtggacttctttccggtc
ctgcgctacctgcccaacccagccctcaagaggtttaagaacttcaatgataactttgtg
ctgtttctgcagaaaacagtccaggaacactatcaagacttcaacaagaacagtatccag
gacatcacaggcgccctgttcaagcacagtgagaactacaaagacaacggtggtctcatc
cctcaggagaagattgtcaacattgtcaatgacatctttggagctggatttgaaacagtc
acaacagccatcttctggagcattttgctacttgtgacagagcccaaggtgcagaggaag
attcatgaggagctggacacggtgattggcagagatcggcagccacggctttctgacaga
ccccagctgccatatctggaggccttcatcctggagatctaccgatacacatcctttgtc
cccttcaccatcccccacagcacaacgagggacacctcactgaatggcttccacattccc
aaggagtgctgcatcttcataaaccagtggcaggtcaaccatgatgagaagcagtggaaa
gacccctttgtgttccgcccagagcggtttcttaccaatgacaacacggccatcgacaag
accctgagtgagaaggtgatgctcttcggcttgggaaagcgccggtgcattggggagatc
ccggccaagtgggaagtcttcctcttcttagccatcctcctgcatcagctggagttcact
gtgccaccgggcgtgaaggtggacctgacacccagctatgggctgaccatgaagcccaga
acctgtgaacacgtccaggcctggccacgcttctccaagtga

DBGET integrated database retrieval system