KEGG   Rattus norvegicus (rat): 24297Help
Entry
24297             CDS       T01003                                 

Gene name
Cyp1a2, CYPD45, P-450d, RATCYPD45
Definition
(RefSeq) cytochrome P450, family 1, subfamily a, polypeptide 2
  KO
K07409  cytochrome P450 family 1 subfamily A polypeptide 2 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00232  Caffeine metabolism
rno00380  Tryptophan metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24297 (Cyp1a2)
   00591 Linoleic acid metabolism
    24297 (Cyp1a2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    24297 (Cyp1a2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24297 (Cyp1a2)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    24297 (Cyp1a2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24297 (Cyp1a2)
   00982 Drug metabolism - cytochrome P450
    24297 (Cyp1a2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    24297 (Cyp1a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24297 (Cyp1a2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP1 family
   24297 (Cyp1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Sec8_exocyst
Motif
Other DBs
NCBI-GeneID: 24297
NCBI-ProteinID: NP_036673
RGD: 2459
Ensembl: ENSRNOG00000016173
UniProt: P04799
Position
8q24
AA seq 513 aa AA seqDB search
MAFSQYISLAPELLLATAIFCLVFWVLRGTRTQVPKGLKSPPGPWGLPFIGHMLTLGKNP
HLSLTKLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLITNGK
SMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSVSSCYLEEHVSKEANHLISKFQKLMA
EVGHFEPVNQVVESVANVIGAMCFGKNFPRKSEEMLNLVKSSKDFVENVTSGNAVDFFPV
LRYLPNPALKRFKNFNDNFVLFLQKTVQEHYQDFNKNSIQDITGALFKHSENYKDNGGLI
PQEKIVNIVNDIFGAGFETVTTAIFWSILLLVTEPKVQRKIHEELDTVIGRDRQPRLSDR
PQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKECCIFINQWQVNHDEKQWK
DPFVFRPERFLTNDNTAIDKTLSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLHQLEFT
VPPGVKVDLTPSYGLTMKPRTCEHVQAWPRFSK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcccagtatatctccttagccccagagctgctactggccactgccatcttc
tgtttagtgttctgggtgttgagaggcacaaggacccaggttcccaaaggtctgaagagt
cctcccggaccctggggcttgcccttcattgggcacatgctgaccctggggaagaaccca
cacctatctctgacaaagctgagtcagcagtatggggacgtgctgcagatccgcattggc
tccacacccgtggtggtgctgagcggcctgaacaccatcaagcaggccctagtgaagcag
ggggatgacttcaaaggccggccagacctctacagcttcacacttatcactaatggcaag
agcatgactttcaacccagactctggaccggtctgggctgcccgccggcgcctggcccag
gatgccctgaagagtttctccatagcctcagaccccacatcagtatcctcttgctacttg
gaggagcacgtgagcaaagaggctaaccatctaatcagcaagttccagaagctgatggca
gaggttggccacttcgaaccagtcaaccaggtggtggaatcggtggctaatgtcatcgga
gccatgtgttttgggaagaacttccccaggaagagcgaggagatgctcaacctcgtgaag
agcagcaaggactttgtggagaatgtcacctcagggaatgctgtggacttctttccggtc
ctgcgctacctgcccaacccagccctcaagaggtttaagaacttcaatgataactttgtg
ctgtttctgcagaaaacagtccaggaacactatcaagacttcaacaagaacagtatccag
gacatcacaggcgccctgttcaagcacagtgagaactacaaagacaacggtggtctcatc
cctcaggagaagattgtcaacattgtcaatgacatctttggagctggatttgaaacagtc
acaacagccatcttctggagcattttgctacttgtgacagagcccaaggtgcagaggaag
attcatgaggagctggacacggtgattggcagagatcggcagccacggctttctgacaga
ccccagctgccatatctggaggccttcatcctggagatctaccgatacacatcctttgtc
cccttcaccatcccccacagcacaacgagggacacctcactgaatggcttccacattccc
aaggagtgctgcatcttcataaaccagtggcaggtcaaccatgatgagaagcagtggaaa
gacccctttgtgttccgcccagagcggtttcttaccaatgacaacacggccatcgacaag
accctgagtgagaaggtgatgctcttcggcttgggaaagcgccggtgcattggggagatc
ccggccaagtgggaagtcttcctcttcttagccatcctcctgcatcagctggagttcact
gtgccaccgggcgtgaaggtggacctgacacccagctatgggctgaccatgaagcccaga
acctgtgaacacgtccaggcctggccacgcttctccaagtga

DBGET integrated database retrieval system