KEGG   Rattus norvegicus (rat): 24299Help
Entry
24299             CDS       T01003                                 

Gene name
Cyp2a3, Cyp2a3a, RATCYP2A3A
Definition
cytochrome P450, family 2, subfamily a, polypeptide 3 (EC:1.14.14.1)
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q21
AA seq 494 aa AA seqDB search
MLASGLLLVASVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNYLQLNTEKMYSSLMK
ISQRYGPVFTIHLGPRRVVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSS
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIESFRKTNGALIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQAKYEDRMKMPYTEAVIHEIQ
RFADMIPMGLARRVTKDTKFREFLLPKGTEVFPMLGSVLKDPKFFSNPNDFNPKHFLDDK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFCFKSPQAPQDIDVSPRLVGF
ATIPPNYTMSFLSR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcaggactccttctggtggcctcagtggccttcctcagtgtcctggtcttg
atgtctgtctggaagcagaggaagctctcagggaagctgcctcctggacccaccccattg
cccttcatcgggaactacctccagctgaacacagagaaaatgtacagctctctcatgaag
atcagccaacgttacggtcctgtattcaccatccacctgggacctcgccgagttgtggtg
ctgtgcggacaggaggcagtcaaggaggctctggtggaccaagctgaggaattcagtggt
cggggagagcaggccaccttcgactggcttttcaaaggctatggggtagccttcagcagc
ggggagcgagccaaacagctaaggcgcttctccatcgccacgctgcgggacttcggcgtg
ggcaagcgtggcatcgaggagcgtatccaagaggaggcgggctttctcatcgagtcattt
cgaaagacgaacggtgccctcattgaccccaccttctatctgagccggacagtctccaat
gtcattagctcaatagtcttcggggaccgcttcgactatgaggacaaagagttcctgtca
ctgcttcgaatgatgctgggaagcttccagttcacagctacctccacggggcagctctat
gagatgttctcttctgtgatgaaacacctgccaggcccccagcaacaggcctttaaggag
ctgcaggggctggaggacttcataaccaagaaggtggaacagaatcagcgcacgctggat
cccaattccccaagggacttcatcgactctttcctcatccgaatgctggaggaaaagaag
aaccccaatactgagttctacatgaagaacttggtgctgactaccctaaatctcttcttt
gccggcacagagaccgtcagcaccaccctgcgttacggctttctgttgctcatgaagcac
ccggatattgaggctaaggtccacgaggagattgaccgggtgattggcaggaaccggcag
gccaagtatgaggaccgaatgaagatgccctacacggaggctgtgatccacgagatccag
agatttgcagacatgatccccatgggcctggctcgcagggtcaccaaggacaccaagttt
cgagagttcctcctccccaagggtactgaagtatttcctatgctgggctctgtactgaaa
gaccctaagttcttctccaaccccaacgacttcaacccaaagcacttcctagatgacaag
ggacagtttaagaagagtgatgcctttgtgcccttttccattggaaaacggtattgtttc
ggggaaggactggcaaggatggaactctttctcttcctcacaaacatcatgcagaacttc
tgcttcaaatccccacaggcaccccaggacatcgatgtgtctcctagacttgtgggcttt
gccacaatcccaccaaactacactatgagtttcttgtcccgttga

DBGET integrated database retrieval system