KEGG   Rattus norvegicus (rat): 24299Help
Entry
24299             CDS       T01003                                 

Gene name
Cyp2a3, Cyp2a3a, RATCYP2A3A
Definition
cytochrome P450, family 2, subfamily a, polypeptide 3 (EC:1.14.14.1)
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24299 (Cyp2a3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24299 (Cyp2a3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   24299 (Cyp2a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q21
AA seq 494 aa AA seqDB search
MLASGLLLVASVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNYLQLNTEKMYSSLMK
ISQRYGPVFTIHLGPRRVVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSS
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIESFRKTNGALIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQAKYEDRMKMPYTEAVIHEIQ
RFADMIPMGLARRVTKDTKFREFLLPKGTEVFPMLGSVLKDPKFFSNPNDFNPKHFLDDK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFCFKSPQAPQDIDVSPRLVGF
ATIPPNYTMSFLSR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcaggactccttctggtggcctcagtggccttcctcagtgtcctggtcttg
atgtctgtctggaagcagaggaagctctcagggaagctgcctcctggacccaccccattg
cccttcatcgggaactacctccagctgaacacagagaaaatgtacagctctctcatgaag
atcagccaacgttacggtcctgtattcaccatccacctgggacctcgccgagttgtggtg
ctgtgcggacaggaggcagtcaaggaggctctggtggaccaagctgaggaattcagtggt
cggggagagcaggccaccttcgactggcttttcaaaggctatggggtagccttcagcagc
ggggagcgagccaaacagctaaggcgcttctccatcgccacgctgcgggacttcggcgtg
ggcaagcgtggcatcgaggagcgtatccaagaggaggcgggctttctcatcgagtcattt
cgaaagacgaacggtgccctcattgaccccaccttctatctgagccggacagtctccaat
gtcattagctcaatagtcttcggggaccgcttcgactatgaggacaaagagttcctgtca
ctgcttcgaatgatgctgggaagcttccagttcacagctacctccacggggcagctctat
gagatgttctcttctgtgatgaaacacctgccaggcccccagcaacaggcctttaaggag
ctgcaggggctggaggacttcataaccaagaaggtggaacagaatcagcgcacgctggat
cccaattccccaagggacttcatcgactctttcctcatccgaatgctggaggaaaagaag
aaccccaatactgagttctacatgaagaacttggtgctgactaccctaaatctcttcttt
gccggcacagagaccgtcagcaccaccctgcgttacggctttctgttgctcatgaagcac
ccggatattgaggctaaggtccacgaggagattgaccgggtgattggcaggaaccggcag
gccaagtatgaggaccgaatgaagatgccctacacggaggctgtgatccacgagatccag
agatttgcagacatgatccccatgggcctggctcgcagggtcaccaaggacaccaagttt
cgagagttcctcctccccaagggtactgaagtatttcctatgctgggctctgtactgaaa
gaccctaagttcttctccaaccccaacgacttcaacccaaagcacttcctagatgacaag
ggacagtttaagaagagtgatgcctttgtgcccttttccattggaaaacggtattgtttc
ggggaaggactggcaaggatggaactctttctcttcctcacaaacatcatgcagaacttc
tgcttcaaatccccacaggcaccccaggacatcgatgtgtctcctagacttgtgggcttt
gccacaatcccaccaaactacactatgagtttcttgtcccgttga

DBGET integrated database retrieval system