KEGG   Rattus norvegicus (rat): 24300Help
Entry
24300             CDS       T01003                                 

Gene name
Cyp2b1, Cyp2b-1, Cypbe
Definition
cytochrome P450, family 2, subfamily b, polypeptide 1 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24300 (Cyp2b1)
   00590 Arachidonic acid metabolism
    24300 (Cyp2b1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24300 (Cyp2b1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    24300 (Cyp2b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24300 (Cyp2b1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   24300 (Cyp2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1
AA seq 491 aa AA seqDB search
MEPSILLLLALLVGFLLLLVRGHPKSRGNFPPGPRPLPLLGNLLQLDRGGLLNSFMQLRE
KYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGRGTIAVIEPIFKEYGVIFANGER
WKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIIC
SIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFFSGFLKYFPGAHRQISKNLQE
ILDYIGHIVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHHTVFHHENLMISLLSLFFAGT
ETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRSKMPYTDAVIHEIQRFS
DLVPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDSFNPEHFLDANGAL
KKSEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSVSSHLAPKDIDLTPKESGIGKI
PPTYQICFSAR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtatcttgctcctccttgctctcctcgtgggcttcttgttactcttagtc
aggggacacccaaagtcccgtggcaacttcccaccaggacctcgtccccttcccctcttg
gggaacctcctgcagttggacagagggggcctcctcaattccttcatgcagcttcgagaa
aaatatggagatgtgttcacagtacacctgggaccaaggcctgtggtcatgctatgtggg
acagacaccataaaggaggctctggtgggccaagctgaggatttctctggtcggggaaca
atcgctgtgattgagccaatcttcaaggaatatggtgtgatctttgccaatggggaacgc
tggaaggcccttcggcgattctctctggctaccatgagagactttgggatgggaaagagg
agtgtggaagaacggattcaggaggaagcccaatgtttggtggaggaactgcggaaatcc
cagggagccccactggatcccaccttcctcttccagtgcatcacagccaacatcatctgc
tccattgtgtttggagagcgctttgactacacagaccgccagttcctgcgcctgttggag
ctgttctaccggaccttttccctcctaagttcattctccagccaggtgtttgagttcttc
tctgggttcctgaaatactttcctggtgcccacagacaaatctccaaaaacctccaggaa
atcctcgattacattggccatattgtggagaagcacagggccaccttagacccaagcgct
ccacgagacttcatcgacacttaccttctgcgcatggagaaggagaagtcgaaccaccac
acagtgttccatcatgagaacctcatgatctccctgctctctctcttctttgctggcact
gagaccagcagcaccacactccgctatggtttcctgctgatgctcaagtacccccatgtc
gcagagaaagtccaaaaggagattgatcaggtgatcggctcacaccggctaccaaccctt
gatgaccgcagtaaaatgccatacactgatgcagttatccatgagattcagaggttttca
gatcttgtccctattggagtaccacacagagtcaccaaagacaccatgttccgagggtac
ctgcttcccaagaacactgaagtgtaccccatcctgagttcagctctccatgacccacag
tactttgaccacccagacagcttcaatcctgaacacttcctggatgccaatggggcactg
aaaaagagtgaagctttcatgcccttctccacaggaaagcgcatttgtcttggcgaaggc
attgcccgaaatgaattgttcctcttcttcaccaccatcctccagaacttctctgtgtca
agccatttggctcccaaggacattgacctcacgcccaaggagagtggcattggaaaaata
cctccaacgtaccagatctgcttctcagctcggtga

DBGET integrated database retrieval system