KEGG   Rattus norvegicus (rat): 24307Help
Entry
24307             CDS       T01003                                 

Gene name
Cyp4b1
Definition
cytochrome P450, family 4, subfamily b, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24307 (Cyp4b1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP4 family
   24307 (Cyp4b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 511 aa AA seqDB search
MVLNFLSPSLSRLGLWASVVILMVIVLKLFSLLLRRQKLARAMDSFPGPPTHWLFGHALE
IQKLGSLDKVVSWAQQFPHAHPLWFGQFVGFLNIYEPDYAKAVYSRGDPKAADVYDFFLQ
WIGKGLLVLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDI
FCDVGHMALDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLT
PHGRRFLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKL
SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQDSFQWDDL
AKMTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRSLPAGSLISLHIYALHRNSTVWP
DPEVFDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP
SKMPIKVPQLILRSKNGIHLYLKPLASRSGK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcaatttcctctccccgagcctttcccggctcggcttgtgggcttctgtagtg
atcctgatggtaatcgttctcaagctcttcagcctgctgcttcggaggcagaagctggcc
agggctatggacagtttcccagggccccccacacactggctttttggtcatgcccttgag
atccagaagttagggagcctggacaaggtggtatcctgggcccaacagttcccccatgcc
cacccactttggtttggacaattcgttggtttcctgaacatctatgagcccgactatgcg
aaagctgtatacagccgcggggatccgaaggctgcagatgtgtatgacttcttcctccag
tggatcgggaaaggcctactagttctggatgggccaaaatggttccagcaccgcaagctg
ctcacacctggcttccattatgatgtgctgaagccctatgtggccatatttgctgagtcc
acacgtatgatgctggacaagtgggagaaaaaggctagtgaaaataagagctttgacatc
ttctgtgacgtaggccacatggccctggacaccctcatgaagtgcaccttcggcaaagga
gacagcggcctaggccacagagacaacagctactacctggcggtcagtgacctcacactg
ctgatgcagcagcgcatcgactccttccagtaccataatgacttcatttactggctcact
ccacatggccgccgcttcctgcgggcctgcaagatagcccatgaccatacagatgaggtc
atcaggcagcggaaggcagcactgcaggatgagaaagagcggaaaaagattcagcagcgg
aggcacctggacttcctggacattctcctgggtgtccgggatgaaagtgggatcaagctg
tcagatgcagagctccgggctgaagtggacacattcatgtttgaaggccatgacaccacc
actagtggtatctcttggtttctctactgcatggccctttaccctgagcaccagcagcta
tgtagggaggaggtccgtgggatcctaggagaccaagactccttccaatgggatgatctg
gccaagatgacctacctgaccatgtgcatgaaggagtgcttccgcctctacccacctgta
ccccaagtataccgccagctcaacaagccagtcaccttcgtggatggccgctctctacct
gcaggcagcctgatctctctgcacatctacgccctccacaggaacagtactgtgtggcct
gatccagaggtctttgacccactgcgcttttctcctgagaatgctgcaggacggcatccc
tttgccttcatgcctttttctgcagggcccaggaattgcatcgggcagcagtttgccatg
aacgagatgaaggtggtcacagccctttgtttactgcgctttgagttctccctggatccc
tcaaagatgcccattaaggtcccccagctgatcttgcgctccaaaaatggtatccacctc
tacctgaagccgctggcttctaggtctggaaagtag

DBGET integrated database retrieval system