KEGG   Rattus norvegicus (rat): 24310Help
Entry
24310             CDS       T01003                                 

Gene name
Ace, CD143, Dcp1, StsRR92
Definition
(RefSeq) angiotensin I converting enzyme (EC:3.4.15.1)
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    24310 (Ace)
   04614 Renin-angiotensin system
    24310 (Ace)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    24310 (Ace)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    24310 (Ace)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     24310 (Ace)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M2
   24310 (Ace)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24310 (Ace)
Cellular antigens [BR:rno04090]
 Proteins
  24310 (Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.1
AA seq 1313 aa AA seqDB search
MGAASGQRGRWPLSPPLLMLSLLLLLLLPPSPAPALDPGLQPGNFSADEAGAQLFADSYN
SSAEVVMFQSTAASWAHDTNITEENARLQEEAALINQEFAEVWGKKAKELYESIWQNFTD
QKLRRIIGSVQTLGPANLPLTQRLQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTN
ILASSRNYAKVLFAWEGWHDAVGIPLKPLYQDFTALSNEAYRQDGFSDTGAYWRSWYESP
SFEESLEHLYHQVEPLYLNLHAFVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWENIY
DMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPADG
REVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLHVSLRRGANP
GFHEAIGDVLALSVSTPAHLHKIGLLDRVANDIESDINYLLKMALEKIAFLPFGYLVDQW
RWGVFSGRTPPSRYNYDWWYLRTKYQGICPPVARNETHFDAGAKFHIPSVTPYIRYFVSF
VLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGAKLQQVLQAGCSRPWQEVLKDLVGSDAL
DASALMEYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLETDEAKANRFVE
EYDRTAKVLWNEYAEANWHYNTNITIEGSKILLQKNKEVSNHTLKYGTWAKTFDVSNFQN
STIKRIIKKVQNVDRAVLPPNELEEYNQILLDMETTYSVANVCYTNGTCLSLEPDLTNIM
ATSRKYEELLWVWKSWRDKVGRAILPFFPKYVDFSNKIAKLNGYSDAGDSWRSSYESDDL
EQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDL
VAPFPSAPSIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGRE
VVCHASAWDFYNGKDFRIKQCTSVNMEELVIAHHEMGHIQYFMQYKDLPVTFREGANPGF
HEAIGDVLALSVSTPKHLHSLNLLSSEGSGYEHDINFLMKMALDKIAFIPFSYLIDQWRW
RVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYIRYFISFII
QFQFHEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGYSKQWPEAMKIITGQPNMSA
SAIMNYFKPLTEWLVTENRRHGETLGWPEYTWTPNTARAEGSLPESSRVNFLGMYLEPQQ
ARVGQWVLLFLGVALLVATVGLAHRLYNIHNHHSLRRPHRGPQFGSEVELRHS
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtccggccagcgggggcggtggccgttgtcaccgccgctcttgatgctg
tcgctgctgctgctgctgctgctgccgccgtcgcccgccccggcgcttgaccctggattg
cagccgggcaacttttccgcggacgaggcaggggcgcagctcttcgctgacagctataac
tcgagtgccgaggtggtgatgttccagagcaccgcagccagctgggcgcacgacaccaac
atcacggaggagaatgcgcggctccaggaggaagcggccctgatcaaccaggagtttgca
gaggtctggggcaagaaggccaaggagctgtatgagtccatctggcagaacttcactgac
caaaagctgcgaaggatcatcggatccgtacagaccctaggacctgccaacctgcccctg
acccagcggctgcagtacaactctctgctaagcaacatgagcagaatctactccaccggc
aaggtctgcttccccaacaagactgccacctgctggtccctggacccagagctcaccaac
atcctggcttcctcacgaaactatgccaaggtgctgtttgcctgggaaggctggcatgat
gctgtgggtatcccactgaagcccctctatcaggactttactgccctcagtaatgaagcc
tacagacaagatggcttctcagacacaggagcctactggcgctcctggtatgagtccccc
tcctttgaagagagtttggagcatctctaccaccaagtcgagcccctctacctgaacctc
catgcctttgtccgtcgcgcactgcaccgccgctatggggacaaatacatcaatctcaga
ggtcctattcccgctcatctgctgggagacatgtgggcgcagagctgggagaacatttac
gacatggtagtgcctttcccggacaaacccaacctcgatgtcaccagtacaatggtacag
aagggctggaatgccacgcacatgttccgggtcgcagaggaattctttacctcgctgggg
ctctcccccatgcctccagagttctgggcggagtcgatgctggagaaaccagctgatgga
cgggaggtggtgtgccatgcctctgcgtgggacttctacaacaggaaggacttcaggatt
aagcagtgcacgcgggtcacgatggaccagctgtccacagtacaccacgagatgggccac
gtgcagtactatctccagtacaaggacctgcacgtctctctgcgtcgaggtgccaaccct
ggcttccacgaggccatcggggatgtactcgctctctctgtctctaccccagcacatctg
cacaaaattggcctgctagaccgtgttgccaatgacatagaaagtgacatcaattacttg
ctaaagatggccctagagaaaattgccttcttgccctttggttacctggtggaccagtgg
cgctggggggtcttcagtggacgtaccccaccctctcgctacaactacgactggtggtat
cttcgaaccaagtatcaggggatctgcccaccagttgctcggaatgaaacccattttgac
gctggggccaagtttcacatcccaagcgtgacaccatacatcaggtactttgtgagtttc
gtgctacagttccagttccatcaagcgctgtgcaaggaggcaggccaccagggtccacta
caccagtgtgacatctaccagtccaccaaggcaggggccaagctccaacaggtgctgcag
gctggctgctccaggccctggcaggaggtgctgaaggacctggtgggttcagatgcgctg
gatgccagtgcgctaatggagtacttccaaccagtaagccagtggctgcaggagcagaat
cagcggaatggcgaggtcctaggctggccggagtatcagtggcgtccaccgttaccagac
aactatccagagggaattgacctagagactgatgaagccaaggctaacaggttcgtggag
gagtatgaccggacagccaaggtgttgtggaacgaatacgcagaggccaactggcattat
aacaccaacattaccatagagggcagcaagatcctgcttcagaaaaacaaggaagtgtcc
aaccataccttgaaatatggcacctgggccaagacatttgacgtgagcaacttccagaac
tctaccatcaagcggatcataaagaaggttcagaacgtggaccgggcagtgctgcctccc
aacgagttagaagagtacaaccagatcctgctagacatggagacgacttacagtgtagcc
aatgtttgctacacaaatggcacttgtctgtcactggagcctgatctgacaaatataatg
gccacgtcccggaaatacgaagaattgctttgggtgtggaagagctggcgagacaaggtg
gggagagccatccttccctttttcccaaagtacgtggacttctccaacaagatcgccaag
ctcaacggctactctgatgcaggggattcctggagatcctcatatgagtccgacgacttg
gagcaagacctggaaaaactataccaggagctgcagccgctctacctgaacctgcatgcc
tatgtgcgccgctccctgcaccgccattatgggtctgagtacatcaacctggatggtccc
attcctgctcacctgctagggaacatgtgggcacagacttggtccaacatctatgacttg
gtggcacccttcccttccgcccccagtatagatgccacggaggccatgataaagcaggga
tggacacccagaaggatatttaaggaagctgacaatttttttacctccctggggctgtta
cctgtgccccctgagttctggaacaagtcaatgttagagaagccaaccgatgggagggag
gtggtgtgccatgcctcagcctgggacttctacaacggcaaggacttcaggatcaagcag
tgtacctctgtgaacatggaggaattggtgatagcccaccacgaaatgggccacatccag
tatttcatgcagtacaaagacttgcctgtgacctttcgggagggcgccaaccccggtttt
catgaggctattggagatgttttggctctgtctgtgtctacacccaagcatctacacagt
ctcaacctgctcagcagtgagggcagtggctacgagcatgacatcaactttctaatgaag
atggcccttgacaagatcgccttcatccccttcagctacctcattgaccagtggcgctgg
agggtctttgacggaagcatcaccaaggagaactacaaccaggagtggtggagtctcaga
ctgaagtaccagggtctctgccctccagtgcctagatcccaaggtgactttgacccaggg
tccaagttccacgttcctgcgaatgtgccatacatcaggtactttatcagcttcatcatc
cagttccagttccacgaggcactatgtcgcgcagccgggcacaccggccccctgtacaag
tgtgatatctaccaatccaaggaagcagggaagctgctggcagatgccatgaagttgggc
tacagtaagcagtggccagaagccatgaagataatcacaggccaacctaacatgtcagcc
tctgccattatgaattacttcaagccactgactgaatggctcgtcacagagaacaggaga
catggagagacactgggctggccggagtacacctggacaccaaacacggctcgtgcagaa
ggctccctcccagagtccagtcgcgtcaacttcctgggtatgtacctggaaccacagcag
gcccgtgtgggccagtgggtgctgctcttcctaggcgtcgccctgctggtggccaccgtg
ggtctcgcccaccgactctacaacatccataaccatcacagcctccgccggccccaccgt
gggccccagtttgggtccgaggtggagctcagacactcctga

DBGET integrated database retrieval system