KEGG   Rattus norvegicus (rat): 24312Help
Entry
24312             CDS       T01003                                 

Gene name
Dhfr, Dhfr1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rno00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rno00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
2q12
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtccgctgaactgcatcgtcgccgtgtcccaaaatatgggcattggcaagaac
ggagacttaccctggcctctgctcaggaatgagttcaagtacttccagagaatgaccaca
acctcttcagtagaaggtaaacagaatctggtgattatgggtaggaaaacctggttctcc
attcctgagaagaatcgacctttaaaggacagaattaatatagttctcagtagagaactc
aaggaaccaccacaaggagctcattttcttgccaaaagtctggatgatgccttaaaactt
attgaacaaccagagctagcaagtaaagtggacatggtctgggtagtcggaggcagctct
gtctaccaggaagccatgaatcagccaggccacctcagactctttgtgacaaggatcatg
caggagtttgaaagtgacacattcttcccagaaattgatttggagaaatataaacttctc
ccagaatacccaggcgtcctctctgagatccaggaggaaaaaggcatcaagtacaagttt
gaagtctatgaaaagaaagactaa

DBGET integrated database retrieval system