KEGG   Rattus norvegicus (rat): 24335Help
Entry
24335             CDS       T01003                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  
erythropoietin
Organism
rno  Rattus norvegicus (rat)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    24335 (Epo)
   04066 HIF-1 signaling pathway
    24335 (Epo)
   04151 PI3K-Akt signaling pathway
    24335 (Epo)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24335 (Epo)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    24335 (Epo)
Cytokines [BR:rno04052]
 Class I cytokines (hematopoietin family)
  Single chain family
   24335 (Epo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q12-q13
AA seq 192 aa AA seqDB search
MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgcttttactatccttgctactgattcctctg
ggcctcccagtcctctgcgctcccccacgcctcatttgcgacagtcgcgttctggagagg
tacatcttggaggccaaggaggcagaaaatgtcacaatgggctgtgcagaaggtcccaga
ctgagtgagaatattaccgtcccagataccaaagtcaacttctacgcttggaaaagaatg
aaggtggaagaacaggctgtagaagtttggcaaggcctgtctctgctctcagaagccatc
ctgcaggcccaggctctgcaggccaattcctcccagccaccagagagtcttcagcttcat
atagacaaagccatcagtgggctacgtagcctcacttcactgcttcgggtgctgggagct
cagaaggaattgatgtcgcctccagacgccacccaagccgctccactccgaacactcaca
gcggatactttctgcaagctcttccgggtctactccaacttcctccgggggaaactgaag
ctgtacacgggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system