KEGG   Rattus norvegicus (rat): 24336Help
Entry
24336             CDS       T01003                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  
erythropoietin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    24336 (Epor)
   04151 PI3K-Akt signaling pathway
    24336 (Epor)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24336 (Epor)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    24336 (Epor)
Cytokine receptors [BR:rno04050]
 Class I cytokine receptor (hematopoietin family receptor)
  24336 (Epor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q13
AA seq 507 aa AA seqDB search
MDQLRVARWPRVSPLCLLLAGAAWASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRALRQKIWPGIPSPENEFEGLFTTHK
GNFQLWLLQRDGCLWWSPSSPFPEDPPAHLEVLSERHWGVTQAGDAGAEDKGPLLEPVGS
ERAQDTYLVLDEWLLPRCPCSENLSGPGDSVDPATMDEGSETSSCPSDLASKPRPEGTSP
SSFEYTILDPSSKLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDTEPLRPSYVACS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaccaactcagggtggcccgctggcctcgggttagccccctgtgtctcctacttgct
ggggcagcctgggcatcctcacccagcctcccggaccccaagtttgagagcaaagccgcc
ctgctggcatcccggggctccgaagaacttctatgcttcacccagcgcttggaagacttg
gtgtgtttctgggaggaagcggcgaactccgggatgggcttcaactacagcttctcttac
cagctcgaaggtgaatcaagaaagtcatgtcgcctgcaccaggcgcccaccgtccgcggc
tccatgcgtttctggtgttcactgccgaccgcggacacgtcgagttttgtgccactggag
ctgcaggtgaccgaggcctccggatctcctcgctaccaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgagcagaagagggcagccac
gtggtgctgcggtggctgccacctcccggggctcctatgaccacccacatccgctacgag
gtggacgtgtcagcaggcaaccgggctggggggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgtcctgagcaacctgcggggcgggacgcgctacaccttcgctgttcga
gcacgcatggccgagccgagcttcagcggattctggagcgcctggtctgagcccgcgtcg
ctactgactgctagcgacttggaccctctcatcttgacgctgtctctcattctcgtcctc
atctcactgttgctgactgtgctggccctgctgtcccaccgccgggctctgcggcagaag
atctggcctggcatcccaagcccagagaatgagtttgagggtctcttcaccacccacaag
ggtaacttccagctatggctgttgcaacgcgatggctgtctgtggtggagcccaagtagc
cccttccctgaggatccacctgcccacctagaggtcctctcagagcgacactggggagtg
actcaggctggggatgcaggggcagaggacaaggggcccttactggagccagtgggcagt
gagcgggcccaggacacctacctggtattggatgaatggttgctaccccggtgcccatgc
agtgagaacctctctgggcctggggacagtgtagaccctgcgactatggatgaaggttca
gaaacatcttcctgcccctctgacttggcttcaaagcccaggccagagggcacctcgcct
tccagctttgagtacaccatcctggaccccagctctaagctcctgtgccctcgggcactg
cctcctgagctaccccccactccacctcacctgaagtacctgtaccttgtggtgtccgat
tccggcatctcaacagattacagctcagggggctcccagggagtccacggggactcatct
gacggcccctactcccacccctatgagaatagccttgttccagacacagagcctctgcgg
cccagctacgtggcctgctcctag

DBGET integrated database retrieval system