KEGG   Rattus norvegicus (rat): 24346Help
Entry
24346             CDS       T01003                                 

Gene name
Ces1c, Es1, Es2
Definition
carboxylesterase 1C (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:rno00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19p11
AA seq 549 aa AA seqDB search
MWLCVLVWASLAACPIWGHPSSPPVVDTTKGKVLGKYVSLEGFTQPVAVFLGVPFAKPPL
GSLRFAPPEPAEPWSFVKNTTTYPPMCSQDGVVGKLLADMLSTGKENIPLEFSEDCLYLN
IYSPADLTKNSRLPVMVWIHGGGLIIGGASPYSGLALSAHENVVVVTIQYRLGIWGLFST
GDEHSRGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESAGGVSVSVLVLSPLAKNLF
HRAISESGVVLTTNLDKKNTQAVAQMIATLSGCNNTSSAAMVQCLRQKTEAELLELTVKL
DNTSMSTVIDGVVLPKTPEEILTEKSFNTVPYIVGFNKQEFGWIIPTMMGNLLSEGRMNE
KMASSLLRRFSPNLNISESVIPAIIEKYLRGTDDPAKKKELLLDMFSDVFFGIPAVLMSR
SLRDAGAPTYMYEFQYRPSFVSDQRPQTVQGDHGDEIFSVFGTPFLKEGASEEETNLSKL
VMKFWANFARNGNPNGEGLPHWPEYDQKEGYLQIGATTQQAQKLKGEEVAFWTELLAKNP
PQTEHTEHT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctgtgttctggtctgggcttctcttgctgcttgcccaatttggggacaccca
tcctcaccaccagtggtggacaccacgaaaggcaaagtcctggggaagtatgtcagctta
gaaggatttacacagcctgtggccgtcttcctgggagtcccttttgccaagcctcctctt
ggatctctgaggtttgctccaccagagcctgcagagccctggagcttcgtgaagaacacc
accacctacccgcctatgtgctcccaagatggagttgtgggaaagttactcgcagatatg
ttgagcaccggaaaagagaatatacctctcgagttttccgaagactgtctctacctgaat
atttacagtcctgctgacttgacaaaaaacagccgattgcctgtgatggtgtggatccat
ggaggtggactaataataggcggagcatcaccctatagtggactagctctctctgcccac
gaaaacgtggtggtggtaaccattcaataccgcctgggtatttggggattgtttagcacc
ggtgatgaacacagccgggggaactgggctcacttggaccagctggctgcactacgctgg
gtccaggataacattgcaaactttggagggaacccggattcagtgaccatctttggagag
tcagcaggaggtgtcagtgtctctgttcttgtcttatctcctctggccaagaacctcttc
cacagagccatttctgagagtggtgtggtcctcactacaaacctggacaagaagaatact
caggctgtggctcaaatgattgctactctttctgggtgtaataacacctcatcagccgcc
atggttcagtgcttgcgccagaagacagaggctgagctcttggagcttacagtgaaactg
gacaatacctccatgtccactgtgattgatggagtggtactgccaaagacaccggaagag
atcctgactgagaagagtttcaacacggtcccctacatagtgggcttcaacaagcaagag
tttggctggatcattccaacgatgatgggaaatctactctctgaaggcagaatgaatgag
aaaatggccagttccctcttgaggaggttcagccctaaccttaacatctctgagagtgtg
attccagcaatcattgagaagtacttaagaggaacagatgaccctgccaaaaagaaggaa
cttctcctggacatgttttcagatgtctttttcggtatcccagctgtactcatgtcccgt
agcctcagagatgccggagcgcccacctacatgtatgagtttcagtatcgcccaagcttc
gtgtctgaccagagaccccagacagttcagggagaccatggtgatgaaatcttctctgta
tttgggactccatttttaaaagagggcgcctcagaagaggagaccaatcttagcaagttg
gtgatgaagttctgggccaactttgctcgaaatgggaacccaaatggagaggggctgcct
cactggccagaatatgatcagaaggaagggtatttgcagattggtgccaccacccagcaa
gcccagaaactgaaaggagaggaagtggctttctggactgagctcttggctaagaatcca
cctcagacagaacacactgaacacacataa

DBGET integrated database retrieval system