KEGG   Rattus norvegicus (rat): 24385Help
Entry
24385             CDS       T01003                                 

Gene name
Gck, GLUKA, RNGK2
Definition
(RefSeq) glucokinase (EC:2.7.1.2)
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Glucagon signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    24385 (Gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24385 (Gck)
   00052 Galactose metabolism
    24385 (Gck)
   00500 Starch and sucrose metabolism
    24385 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    24385 (Gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    24385 (Gck)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    24385 (Gck)
   04910 Insulin signaling pathway
    24385 (Gck)
   04922 Glucagon signaling pathway
    24385 (Gck)
   04917 Prolactin signaling pathway
    24385 (Gck)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    24385 (Gck)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    24385 (Gck)
   04950 Maturity onset diabetes of the young
    24385 (Gck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     24385 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14q21
AA seq 465 aa AA seqDB search
MAMDTTRCGAQLLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDLDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSANPGQQLYEKIIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLRPS
VTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLAQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctatggatactacaaggtgtggagcccagttgttgactctggtcgagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaggctggagacccacgaggaggccagtgtaaagatgttacccacc
tacgtgcgttccaccccagaaggctcagaagtcggagactttctctccttagacctggga
ggaaccaacttcagagtgatgctggtcaaagtgggagagggggaggcagggcagtggagc
gtgaagacaaaacaccagatgtactccatccccgaggacgccatgacgggcactgccgag
atgctctttgactacatctctgaatgcatctctgacttccttgacaagcatcagatgaag
cacaagaaactgcccctgggcttcaccttctccttccctgtgaggcacgaagacctagac
aagggcatcctcctcaattggaccaagggcttcaaggcctctggagcagaagggaacaac
atcgtaggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaacgacacagtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcactggctgcaatgcctgctacatggaggaaatgcagaat
gtggagctggtggaaggggatgagggacgcatgtgcgtcaacacggagtggggcgccttc
ggggactcgggcgagctggatgagttcctactggagtatgaccggatggtggatgaaagc
tcagcgaaccccggtcagcagctgtacgagaagatcatcggtgggaagtatatgggcgag
ctggtacgacttgtgctgcttaagctggtggacgagaaccttctgttccacggagaggcc
tcggagcagctgcgcacgcgtggtgcttttgagacccgtttcgtgtcacaagtggagagc
gactccggggaccgaaagcagatccacaacatcctaagcactctggggcttcgaccctct
gtcaccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccat
atgtgctccgcaggactagctggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcatcgaa
tcagaggagggcagcggcaggggagccgcgctggtctctgcggtggcctgcaagaaggct
tgcatgctggcccagtga

DBGET integrated database retrieval system