KEGG   Rattus norvegicus (rat): 24398Help
Entry
24398             CDS       T01003                                 

Gene name
Gls, Glut, RATGLUT
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rno00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rno00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:rno00471]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:rno04964]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:rno04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:rno04727]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
9q31-q32
AA seq 603 aa AA seqDB search
MMRLRGSAMLRELLLRPPAAVGGVLRRAQPLGTLCRRPRGGSRPAAGLVAAARLHPWWGG
GGRAKGPGSGGLSSSPSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAF
GNSEGKEMVAAGDNKVKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRL
KECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELY
ESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAI
AVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKF
DYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYF
QLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFH
VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRH
FAKKLDPRREGGDQRHSFGPLDYESLQQELALKDTVWKKVSPESSDDTSTTIVYRMESLG
ERS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggagctgctcttgaggccgcctgccgcc
gtcggaggcgtcttgcggcgcgcgcagcccctcggtacgctgtgccggcgcccccggggc
gggagccggccggccgctggcctggtggccgctgcgcgactccacccgtggtggggcggg
ggcggccgcgcgaagggcccgggctcgggcggcctgtccagctcgccctcggagatcctg
caggagctgggcaaggggggcacgccgccacagcagcagcagcagcagcagcagcagcca
ggggcgtcgccacccgcagccccgggccccaaggacagcccgggggagacggacgcgttc
ggcaacagcgaaggcaaggagatggtggctgcgggcgacaataaagtaaagcagggtctg
ttacctagcttggaagatttgctgttctatacaattgcagaaggacaagaaaagatacct
gttcacaagtttattacagcactcaaatctacaggattgcgaacatctgatcccaggttg
aaagagtgtatggatatgttaagattaactcttcagacaacgtcagatggtgtcatgcta
gacaaagatctttttaaaaagtgtgttcaaagcaacatcgttttgttaacacaagcattt
agaagaaagtttgtcatccctgactttatgtcttttacctcacacatcgatgagttatat
gaaagtgctaaaaagcagtctggagggaaggttgctgattatattcctcaactggccaaa
ttcagtcctgatttgtggggtgtatctgtttgtaccgtagatgggcaaaggcattctatt
ggagataccaaagttcccttttgtcttcagtcctgtgtaaagcccctgaaatatgcaatt
gctgtcaatgacctgggaactgagtatgtgcatcgctatgttgggaaggagccaagtgga
ttaagattcaacaagctctttttgaatgaagatgataaaccacataatccgatggtaaat
gctggagcaattgttgtgacttcactaataaagcaaggagtaaataatgctgagaaattt
gactatgtgatgcaatttttgaataagatggctggtaatgaatatgtcggattcagtaat
gcaacgtttcaatctgaacgagaaagtggagaccgaaattttgcaataggatattactta
aaagaaaagaagtgttttccagaaggcacagacatggttgggatactagatttttatttc
cagctctgttccattgaagtgacgtgtgagtcagcaagtgtgatggctgcaaccttggct
aatggcggtttctgcccaattactggtgaaagagtgctcagtcctgaggccgttcggaat
accctgagcttaatgcactcctgtggcatgtatgacttctcagggcagtttgcatttcat
gttggtcttcctgcaaaatctggagttgctgggggtattcttttagttgtccccaacgtc
atgggcatgatgtgttggtctcctcctcttgacaagatgggcaacagtgttaaaggaatt
cacttttgtcacgatcttgtttctctgtgtaacttccataactatgataatttgagacac
tttgcaaaaaaacttgatcctcggagagaaggaggtgatcaaaggcattcctttggacca
ttggactatgagagtctccagcaagaacttgctttaaaagacacagtgtggaaaaaagtg
tcacctgagtcaagtgacgacacgtctacaactatagtgtatagaatggaaagtctgggg
gagaggagctag

DBGET integrated database retrieval system