KEGG   Rattus norvegicus (rat): 24398Help
Entry
24398             CDS       T01003                                 

Gene name
Gls, Glut, RATGLUT
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24398 (Gls)
   00330 Arginine and proline metabolism
    24398 (Gls)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    24398 (Gls)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    24398 (Gls)
  Nervous system
   04724 Glutamatergic synapse
    24398 (Gls)
   04727 GABAergic synapse
    24398 (Gls)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    24398 (Gls)
   05206 MicroRNAs in cancer
    24398 (Gls)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     24398 (Gls)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
9q31-q32
AA seq 603 aa AA seqDB search
MMRLRGSAMLRELLLRPPAAVGGVLRRAQPLGTLCRRPRGGSRPAAGLVAAARLHPWWGG
GGRAKGPGSGGLSSSPSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAF
GNSEGKEMVAAGDNKVKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRL
KECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELY
ESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAI
AVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKF
DYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYF
QLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFH
VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRH
FAKKLDPRREGGDQRHSFGPLDYESLQQELALKDTVWKKVSPESSDDTSTTIVYRMESLG
ERS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggagctgctcttgaggccgcctgccgcc
gtcggaggcgtcttgcggcgcgcgcagcccctcggtacgctgtgccggcgcccccggggc
gggagccggccggccgctggcctggtggccgctgcgcgactccacccgtggtggggcggg
ggcggccgcgcgaagggcccgggctcgggcggcctgtccagctcgccctcggagatcctg
caggagctgggcaaggggggcacgccgccacagcagcagcagcagcagcagcagcagcca
ggggcgtcgccacccgcagccccgggccccaaggacagcccgggggagacggacgcgttc
ggcaacagcgaaggcaaggagatggtggctgcgggcgacaataaagtaaagcagggtctg
ttacctagcttggaagatttgctgttctatacaattgcagaaggacaagaaaagatacct
gttcacaagtttattacagcactcaaatctacaggattgcgaacatctgatcccaggttg
aaagagtgtatggatatgttaagattaactcttcagacaacgtcagatggtgtcatgcta
gacaaagatctttttaaaaagtgtgttcaaagcaacatcgttttgttaacacaagcattt
agaagaaagtttgtcatccctgactttatgtcttttacctcacacatcgatgagttatat
gaaagtgctaaaaagcagtctggagggaaggttgctgattatattcctcaactggccaaa
ttcagtcctgatttgtggggtgtatctgtttgtaccgtagatgggcaaaggcattctatt
ggagataccaaagttcccttttgtcttcagtcctgtgtaaagcccctgaaatatgcaatt
gctgtcaatgacctgggaactgagtatgtgcatcgctatgttgggaaggagccaagtgga
ttaagattcaacaagctctttttgaatgaagatgataaaccacataatccgatggtaaat
gctggagcaattgttgtgacttcactaataaagcaaggagtaaataatgctgagaaattt
gactatgtgatgcaatttttgaataagatggctggtaatgaatatgtcggattcagtaat
gcaacgtttcaatctgaacgagaaagtggagaccgaaattttgcaataggatattactta
aaagaaaagaagtgttttccagaaggcacagacatggttgggatactagatttttatttc
cagctctgttccattgaagtgacgtgtgagtcagcaagtgtgatggctgcaaccttggct
aatggcggtttctgcccaattactggtgaaagagtgctcagtcctgaggccgttcggaat
accctgagcttaatgcactcctgtggcatgtatgacttctcagggcagtttgcatttcat
gttggtcttcctgcaaaatctggagttgctgggggtattcttttagttgtccccaacgtc
atgggcatgatgtgttggtctcctcctcttgacaagatgggcaacagtgttaaaggaatt
cacttttgtcacgatcttgtttctctgtgtaacttccataactatgataatttgagacac
tttgcaaaaaaacttgatcctcggagagaaggaggtgatcaaaggcattcctttggacca
ttggactatgagagtctccagcaagaacttgctttaaaagacacagtgtggaaaaaagtg
tcacctgagtcaagtgacgacacgtctacaactatagtgtatagaatggaaagtctgggg
gagaggagctag

DBGET integrated database retrieval system