KEGG   Rattus norvegicus (rat): 24404Help
Entry
24404             CDS       T01003                                 

Gene name
Gpx1, GSHPx, GSHPx-1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rno00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:rno04918]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:rno05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8
AA seq 201 aa AA seqDB search
MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIEALLSKQPSNP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctcggctctccgcggtggcacagtccaccgtgtatgccttctccgcgcgc
ccgctggcgggcggggagcccgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtccctctgaggcaccacgacccgggactacaccgaaatgaatgatctg
cagaagcgtctggggcctcgtggcctggtggtgctcggtttcccgtgcaatcagttcgga
catcaggagaatggcaagaatgaagagattctgaattccctcaagtatgtccgacccggt
ggtgggttcgagcccaactttacattgtttgagaagtgcgaggtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccagcacccagtgacgatcccactgcg
ctcatgaccgaccccaagtacatcatttggtccccggtgtgccgcaacgacatttcctgg
aactttgagaagttcctggtaggtccagacggtgttccagtgcgcagatacagcaggcgc
tttcgcaccatcgacatcgaacccgatatagaagccctgctgtccaagcagcctagcaac
ccctaa

DBGET integrated database retrieval system