KEGG   Rattus norvegicus (rat): 24404Help
Entry
24404             CDS       T01003                                 

Gene name
Gpx1, GSHPx, GSHPx-1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    24404 (Gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    24404 (Gpx1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    24404 (Gpx1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    24404 (Gpx1)
   05016 Huntington's disease
    24404 (Gpx1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     24404 (Gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8
AA seq 201 aa AA seqDB search
MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIEALLSKQPSNP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctcggctctccgcggtggcacagtccaccgtgtatgccttctccgcgcgc
ccgctggcgggcggggagcccgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtccctctgaggcaccacgacccgggactacaccgaaatgaatgatctg
cagaagcgtctggggcctcgtggcctggtggtgctcggtttcccgtgcaatcagttcgga
catcaggagaatggcaagaatgaagagattctgaattccctcaagtatgtccgacccggt
ggtgggttcgagcccaactttacattgtttgagaagtgcgaggtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccagcacccagtgacgatcccactgcg
ctcatgaccgaccccaagtacatcatttggtccccggtgtgccgcaacgacatttcctgg
aactttgagaagttcctggtaggtccagacggtgttccagtgcgcagatacagcaggcgc
tttcgcaccatcgacatcgaacccgatatagaagccctgctgtccaagcagcctagcaac
ccctaa

DBGET integrated database retrieval system