KEGG   Rattus norvegicus (rat): 24404Help
Entry
24404             CDS       T01003                                 

Gene name
Gpx1, GSHPx, GSHPx-1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    24404 (Gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    24404 (Gpx1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    24404 (Gpx1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    24404 (Gpx1)
   05016 Huntington's disease
    24404 (Gpx1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     24404 (Gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 24404
NCBI-ProteinID: NP_110453
RGD: 2729
UniProt: P04041
Position
8q32
AA seq 201 aa AA seqDB search
MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIEALLSKQPSNP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctcggctctccgcggtggcacagtccaccgtgtatgccttctccgcgcgc
ccgctggcgggcggggagcccgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtccctctgaggcaccacgacccgggactacaccgaaatgaatgatctg
cagaagcgtctggggcctcgtggcctggtggtgctcggtttcccgtgcaatcagttcgga
catcaggagaatggcaagaatgaagagattctgaattccctcaagtatgtccgacccggt
ggtgggttcgagcccaactttacattgtttgagaagtgcgaggtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccagcacccagtgacgatcccactgcg
ctcatgaccgaccccaagtacatcatttggtccccggtgtgccgcaacgacatttcctgg
aactttgagaagttcctggtaggtccagacggtgttccagtgcgcagatacagcaggcgc
tttcgcaccatcgacatcgaacccgatatagaagccctgctgtccaagcagcctagcaac
ccctaa

DBGET integrated database retrieval system