KEGG   Rattus norvegicus (rat): 24408Help
Entry
24408             CDS       T01003                                 

Gene name
Grin1, GluN1, NMDAR1, NR1
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 1
  KO
K05208  
glutamate receptor ionotropic, NMDA 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24408 (Grin1)
   04015 Rap1 signaling pathway
    24408 (Grin1)
   04020 Calcium signaling pathway
    24408 (Grin1)
   04024 cAMP signaling pathway
    24408 (Grin1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24408 (Grin1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    24408 (Grin1)
   04720 Long-term potentiation
    24408 (Grin1)
  Environmental adaptation
   04713 Circadian entrainment
    24408 (Grin1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24408 (Grin1)
   05014 Amyotrophic lateral sclerosis (ALS)
    24408 (Grin1)
   05016 Huntington's disease
    24408 (Grin1)
  Substance dependence
   05030 Cocaine addiction
    24408 (Grin1)
   05031 Amphetamine addiction
    24408 (Grin1)
   05033 Nicotine addiction
    24408 (Grin1)
   05034 Alcoholism
    24408 (Grin1)
Ion channels [BR:rno04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   24408 (Grin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p13
AA seq 938 aa AA seqDB search
MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgcacctgctgacattcgccctgcttttttcctgctccttcgcccgcgcc
gcctgcgaccccaagatcgtcaacatcggcgcggtgctgagcacgcgcaagcatgaacag
atgttccgcgaggcagtaaaccaggccaataagcgacacggctcttggaagatacagctc
aacgccacttctgtcacccacaagcccaacgccatacagatggccctgtcagtgtgtgag
gacctcatctctagccaggtctacgctatcctagttagccacccgcctactcccaacgac
cacttcactcccacccctgtctcctacacagctggcttctacagaatccctgtcctggga
ctgactacccgaatgtccatctactctgacaagagtatccacctgagtttccttcgcacg
gtgccgccctactcccaccagtccagcgtctggtttgagatgatgcgagtctacaactgg
aaccacatcatcctgctggtcagcgacgaccacgagggacgggcagcgcagaagcgcttg
gagacgttgctggaggaacgggagtccaaggcagagaaggtgctgcagtttgacccagga
accaagaatgtgacggctctgctgatggaggcccgggaactggaggcccgggtcatcatc
ctttctgcaagcgaggacgacgctgccacagtgtaccgcgcagccgcaatgctgaacatg
acgggctctgggtacgtgtggctggtcggggaacgcgagatctctgggaacgccctgcgc
tacgctcctgatggcatcatcggacttcagctcatcaatggcaagaatgagtcagcccac
atcagtgacgccgtgggcgtggtggcacaggcagttcacgaactcctagagaaggagaat
atcactgacccaccgcggggttgcgtgggcaacaccaacatctggaagacaggaccattg
ttcaagagggtgctgatgtcttctaagtatgcggacggagtgactggccgtgtggaattc
aatgaggatggggaccggaagtttgccaactatagtatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggtacccatgtcatcccaaatgacaggaagatcatc
tggccaggaggagagacagagaaacctcgaggataccagatgtccaccagactaaagata
gtgacaatccaccaagagcccttcgtgtacgtcaagcccacaatgagtgatgggacatgc
aaagaggagttcacagtcaatggtgacccagtgaagaaggtgatctgtacggggcctaat
gacacgtccccaggcagcccacgccacacagtgccccagtgctgctatggcttctgcata
gacctgctcatcaagctggcgcggaccatgaattttacctatgaggtgcacctggtggca
gatggcaagtttggcacacaggagcgggtaaacaacagcaacaaaaaggagtggaacgga
atgatgggcgagctactcagtggccaagcggacatgattgtggcaccactgaccatcaac
aatgagcgtgcgcagtacatagagttctccaagcccttcaagtaccagggcctgaccatt
ttggtcaagaaggagattcccaggagcacactggactcatttatgcagccttttcagagc
acactgtggttgctagtaggactgtcagttcatgtggtggctgtgatgctgtacctgctg
gaccgcttcagtccctttggccgattcaaggtgaacagtgaggaggaggaggaagatgca
ctgaccctgtcctctgccatgtggttttcctggggcgtcctgctcaactccggcattggg
gaaggtgccccccggagtttctctgcacgtatcctaggcatggtgtgggctggtttcgcc
atgatcatagtggcttcctacactgccaacttggcagctttcctggtgctggatcggcct
gaggagcgcatcacgggcatcaatgaccccaggctcagaaacccctcagacaagttcatc
tacgcaactgtaaagcagagctccgtggacatctacttccggaggcaggtggagttgagt
accatgtaccggcacatggaaaaacacaattacgagagcgcagctgaggccatccaggct
gtgcgggacaacaagctgcacgcctttatctgggactcggccgtgctggagtttgaggct
tcacagaagtgcgatctggtgaccacgggtgagctgttcttccgctcaggctttggcatc
ggcatgcgcaaggacagcccctggaagcagaacgtttccctgtccatactcaagtcccat
gagaatggcttcatggaagatctggataagacatgggttcggtatcaggaatgcgactcc
cgcagcaatgctcctgcaaccctcacttttgagaacatggcaggggtcttcatgctggtg
gctggaggcatcgtagctgggattttcctcattttcattgagatcgcctacaagcgacac
aaggatgcccgtaggaagcagatgcagctggcttttgcagccgtgaacgtgtggaggaag
aacctgcaggatagaaagagtggtagagcagagcccgaccctaaaaagaaagccacattt
agggctatcacctccaccctggcctccagcttcaagagacgtaggtcctccaaagacacg
agcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcgacgc
gctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

DBGET integrated database retrieval system