KEGG   Rattus norvegicus (rat): 24409Help
Entry
24409             CDS       T01003                                 

Gene name
Grin2a, GluN2A, NMDAR2A, NR2A
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2A
  KO
K05209  
glutamate receptor ionotropic, NMDA 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24409 (Grin2a)
   04015 Rap1 signaling pathway
    24409 (Grin2a)
   04020 Calcium signaling pathway
    24409 (Grin2a)
   04024 cAMP signaling pathway
    24409 (Grin2a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24409 (Grin2a)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    24409 (Grin2a)
   04728 Dopaminergic synapse
    24409 (Grin2a)
   04720 Long-term potentiation
    24409 (Grin2a)
  Environmental adaptation
   04713 Circadian entrainment
    24409 (Grin2a)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    24409 (Grin2a)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24409 (Grin2a)
   05014 Amyotrophic lateral sclerosis (ALS)
    24409 (Grin2a)
  Substance dependence
   05030 Cocaine addiction
    24409 (Grin2a)
   05031 Amphetamine addiction
    24409 (Grin2a)
   05033 Nicotine addiction
    24409 (Grin2a)
   05034 Alcoholism
    24409 (Grin2a)
Ion channels [BR:rno04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   24409 (Grin2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11
AA seq 1464 aa AA seqDB search
MGRLGYWTLLVLPALLVWRDPAQNAAAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQA
TGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILT
TAASSMLEKFSYIPEAKASCYGQAEKPETPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTRFNQRGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRATDFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGDNM
NELQTFVANRHKDNLSNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMES
LRQDSLNQNPVSQRDEKTAENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNH
KTKDNFKRSMASKYPKDCSDVDRTYMKTKASSPRDKIYTIDGEKEPSFHLDPPQFVENIT
LPENVGFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKHFTLKDKGSPH
SEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREEVYQQDWSQNNALQFQKNKLRINRQHSYDNILDKPREIDLSRPSRSISLKDRERLL
EGNLYGSLFSVPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHASDNPFLHTYGDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYS
TPRVLNSCSNRRVYKKMPSIESDV
NT seq 4395 nt NT seq  +upstreamnt  +downstreamnt
atgggcagattgggctactggaccttgctggtattgccggcccttctggtctggcgcgat
ccggcgcagaacgcggcggcggagaagggtcctccagcgctgaacattgcggtgctgctg
ggtcacagccacgacgtgacagaacgcgaacttcgaaatctgtggggcccagagcaggca
accggcttgcccctggatgtgaacgtggtggcgttattgatgaaccgcactgaccctaag
agcctcatcacgcatgtgtgcgacctcatgtccggggcgcgcatccacggcttggtgttt
ggagatgacacggaccaggaggctgtggcccagatgctggattttatctcctcacagact
tttatccccatcttgggcattcatgggggtgcatctatgatcatggctgacaaggatccg
acatccacgttcttccagtttggagcctccatccagcagcaagccacagttatgctgaag
atcatgcaggactacgactggcacgtcttctccctggtcaccaccatcttccctggctac
cgagacttcatcagctttatcaagacaacagtggacaacagctttgtgggctgggatatg
cagaacgtgatcacactggacacctccttcgaggacgccaagacgcaggtccagctgaag
aagatccattcttctgtcatcctgctctactgctccaaagacgaggctgtcctcatcctg
agcgaggctcgctccctcggcctcactggctatgatttcttctggattgtccccagtttg
gtgtctgggaacacagagctcatccccaaagagtttccatcaggtctcatttcagtctct
tatgacgactgggactacagcctggaggcaagagtgagagacggtcttgggatcttaacc
actgccgcatcctccatgttggagaagttctcctacattcctgaggccaaggccagctgc
tatgggcaggcagagaagccagagaccccgctacacaccctgcaccaattcatggtcaat
gtgacttgggatggcaaggacttgtccttcactgaggaaggttaccaggtgcaccccagg
cttgtggtgatcgtgctgaacaaggaccgggagtgggaaaaggtgggcaagtgggagaac
cagacgctgagcctgaggcacgctgtgtggccaaggtacaagtccttttctgactgcgag
ccagatgacaaccacctcagcattgtcaccttggaggaagcccccttcgtcatcgtagag
gacatagaccccctgactgagacctgtgtgaggaacacggtgccctgtcggaagttcgtc
aagatcaacaattcaaccaacgaagggatgaatgtgaagaaatgctgcaaggggttctgc
atcgacatcctcaagaagctgtccagaactgtgaagttcacctatgacctctacctggtg
accaatgggaagcatgggaaaaaggttaacaatgtgtggaatggaatgataggtgaagtg
gtctatcaacgagcagtcatggctgtgggctcactcaccatcaatgaggagcgttcggaa
gtggtggacttctcggtgcccttcgtggagacaggaatcagcgtcatggtctccaggagt
aatggcactgtctccccttctgctttcctcgaacccttcagtgcctccgtctgggtgatg
atgtttgtgatgctgctcatcgtctcagccattgctgtcttcgtttttgaatacttcagt
cctgttggatacaacagaaacttagccaaagggaaagctccccacgggccttcttttact
attggaaaagctatatggctcctctggggcctggtcttcaacaattctgtgcctgtccag
aatcctaaaggcacaaccagcaagatcatggtgtcagtgtgggccttctttgctgtcatc
ttcctggccagttacacagccaacctggctgccttcatgatccaggaggagtttgtggac
caagtgactggcctcagtgacaagaagttccagagacctcatgactattctccacctttc
cgatttgggacggtacccaatggaagtacagagaggaatattcgtaacaactacccgtat
atgcaccagtacatgaccagattcaaccagaggggagtggaggatgccttggtcagcttg
aaaaccgggaagttggacgctttcatctatgacgcagccgtcttgaactacaaggccggg
agggatgaaggctgtaaactggtgaccattgggagcgggtacatctttgctaccacaggc
tatggaattgcgctgcagaagggctcaccctggaagaggcagattgacctcgctctgctc
cagtttgttggtgatggtgagatggaggagctggagacactgtggcttacgggcatctgc
cacaacgagaagaatgaggtgatgagtagccagctggacatcgataacatggcgggcgtg
ttctacatgctggctgcagccatggccctcagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgcttcacaggcgtgtgctctgaccggcccgggctgctc
ttctccatcagcaggggcatctatagttgcatccatggggtacacattgaagaaaagaag
aaatctccagatttcaatctgactggatcacagagcaacatgctaaagcttcttcggtca
gctaaaaacatctccaatatgtccaacatgaactcctcaagaatggactcacctaaaaga
gctactgacttcattcaaagagggtcacttattgtggacatggtttcagacaagggaaat
ttgatatattcagacaacagatcctttcaagggaaggacagtatatttggagacaacatg
aatgaactccaaacatttgtggccaacaggcacaaggataatctcagtaactatgtgttt
caaggacagcatcctctcactctcaatgagtccaaccctaacacagtagaggtggctgtc
agcactgaatccaaagggaactcccgaccccggcagctttggaagaaatccatggagtct
ctacgccaggattctctaaaccagaacccagtctcccagagggatgagaagactgcagag
aatcggacccactcgctaaagagtcctaggtatcttccagaagaggtagcccactctgac
atttcagaaacctcaagccgggccacatgccacagggagccagataacaataagaaccac
aagaccaaggataacttcaaacggtcaatggcctctaagtatcccaaggactgtagcgat
gttgaccgcacctacatgaaaaccaaagcaagttctcccagggataagatctataccatt
gatggtgagaaggagcccagcttccacttagatcctcctcagtttgttgagaatataacc
ctgcctgagaatgtgggcttcccagatacctaccaagatcacaatgagaacttccgcaag
ggggactccacactgcccatgaacaggaacccattacataatgaagacgggcttcccaac
aatgaccaatataaactctatgccaagcactttaccttgaaagacaagggttccccacac
agtgagggcagtgatcgataccggcagaactccacacattgcagaagctgcctttcgaat
ctgcccacctactcaggccactttaccatgaggtctcctttcaagtgtgatgcctgtctg
cggatggggaatctctatgacattgatgaagaccagatgcttcaggagacaggtaaccca
gctactcgggaggaggtctaccagcaggactggtcacagaacaacgccctccagttccag
aagaacaagctaaggattaaccgacagcactcctatgataacattctggacaaacccaga
gagatagaccttagcaggccctcccggagcataagcctcaaggacagggaacggctactg
gagggcaacttgtatgggagcctgttcagtgtcccctcaagcaaactcttggggaacaaa
agctcccttttcccccaaggtctggaggacagcaagaggagcaagtctctcttgccagac
cacgcctccgataatcctttcctccacacgtatggggatgaccaacgcttagttatcggg
agatgtccctcggacccttacaaacactcattgccatcacaggcggtaaatgacagctat
cttcggtcatccttgaggtcaacagcatcatattgctccagggacagtcggggccacagt
gatgtgtatatttcagagcatgttatgccttatgctgcaaataagaataccatgtactct
acccccagggttttaaattcctgcagcaatagacgagtgtacaagaaaatgcctagtatc
gaatctgatgtttaa

DBGET integrated database retrieval system