KEGG   Rattus norvegicus (rat): 24410Help
Entry
24410             CDS       T01003                                 

Gene name
Grin2b, GluN2B
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2B
  KO
K05210  
glutamate receptor ionotropic, NMDA 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24410 (Grin2b)
   04015 Rap1 signaling pathway
    24410 (Grin2b)
   04024 cAMP signaling pathway
    24410 (Grin2b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24410 (Grin2b)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    24410 (Grin2b)
   04728 Dopaminergic synapse
    24410 (Grin2b)
   04720 Long-term potentiation
    24410 (Grin2b)
  Environmental adaptation
   04713 Circadian entrainment
    24410 (Grin2b)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    24410 (Grin2b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24410 (Grin2b)
   05014 Amyotrophic lateral sclerosis (ALS)
    24410 (Grin2b)
   05016 Huntington's disease
    24410 (Grin2b)
  Substance dependence
   05030 Cocaine addiction
    24410 (Grin2b)
   05031 Amphetamine addiction
    24410 (Grin2b)
   05033 Nicotine addiction
    24410 (Grin2b)
   05034 Alcoholism
    24410 (Grin2b)
Ion channels [BR:rno04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   24410 (Grin2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q43
AA seq 1482 aa AA seqDB search
MKPSAECCSPKFWLVLAVLAVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGEKHGVVGGVPAPWEKN
LTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISKDNSL
QELDQPAAPVAVTSNASSTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVPTAGHHHNNPGSGYMLSKSLYPDRV
TQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVSALHGAVPGRF
QKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4449 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagcgcagagtgctgttcccccaagttctggttggtgttggccgtcttggcc
gtatcaggcagcaaagctcgttcccaaaagagcccccccagcatcggcatcgctgtcatc
ctcgtgggcacttcagacgaagtggccataaaagacgcccacgagaaagatgacttccat
catctctcagtagttccccgggtggagctggtagccatgaacgaaactgacccaaagagc
atcatcacccgtatctgcgatcttatgtctgaccggaagatccagggggtggtgttcgcg
gatgacaccgaccaagaagccatcgctcagatcctcgacttcatttctgctcagactctc
acccccatcctgggcatccatgggggctcatctatgataatggcggataaggatgagtcc
tccatgttcttccagtttggcccgtctatcgaacagcaagcttccgtcatgctcaacatc
atggaagaatatgactggtacatcttttccatcgtcaccacctacttccctggctaccag
gactttgtgaacaagatccgcagtaccatcgagaacagcttcgtgggctgggagctcgag
gaagtcctcctgctagacatgtctctggacgatggcgactctaagattcagaatcagctg
aagaagctccaaagccccatcattctcctttattgcacgaaggaggaagccacctacatt
tttgaagtagctaactcagttgggctgactggctacggctacacgtggattgtgccgagt
ctggtggccggggatacggacacggtgccttcagagttccccacggggcttatctctgtg
tcttatgatgaatgggactatggccttcctgccagagtgagagatggaattgccatcatc
accactgctgcctcggacatgctgtccgaacacagtttcatccctgagcccaagagcagt
tgctacaacacccacgagaagaggatctaccagtctaacatgttgaataggtatctgatc
aatgtcacttttgaagggagaaacctgtccttcagcgaagatggctaccagatgcatccg
aagctggtgataatccttctgaacaaggagaggaagtgggagagggtggggaaatggaag
gacaagtccctgcagatgaagtattatgtgtggcctcggatgtgtcctgagactgaggag
caagaggatgaccatctgagcattgtcaccttggaggaggcgccatttgtcattgtggaa
agcgtggaccctctcagtggaacctgcatgaggaatacagtcccgtgccagaagcgcatc
atctctgagaataaaacagatgaggaaccaggctacatcaaaaaatgctgcaaggggttc
tgtattgacatccttaagaaaatttctaagtctgtgaagttcacctatgacctttacctg
gtgaccaatggcaagcacgggaagaagattaatgggacctggaatggcatgatcggtgag
gtggtcatgaagagggcctacatggcagtgggatcactaactatcaatgaagaacggtca
gaggtggttgacttctctgtacccttcatagaaactggcatcagtgtcatggtatctcgc
agcaatgggactgtgtcaccttctgccttcttagagccattcagcgctgacgtgtgggtg
atgatgtttgtgatgctgctcattgtttctgcggtggctgtctttgtctttgaatacttc
agccctgtgggttacaacaggtgcctagccgatggcagagagccaggaggcccatctttc
accatcggcaaagcaatttggttactctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
attttcctggccagctacactgccaacttagcagccttcatgatccaagaggagtatgtg
gaccaggtttctggcctgagtgacaagaagttccagagacctaatgacttctcaccccct
ttccgctttgggactgtgcccaatggcagcacagagaggaatatccgtaataactatgca
gaaatgcatgcctacatgggaaagttcaaccaaaggggtgtagatgatgcattgctctcc
ctgaaaacagggaagcttgatgcattcatctatgatgcagctgtgctcaactacatggct
ggaagggacgaaggctgcaaactggtgaccattggcagtggcaaggtctttgcttctacc
ggctatggcattgctatccaaaaggactccgggtggaagcgccaggtggacctggctatc
ctgcagctgtttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgccacaatgagaagaatgaggtgatgagcagccagctggacatcgacaatatggcaggt
gtcttctatatgttgggggcagccatggccctcagcctcatcaccttcatctgtgagcat
ctgttctattggcagttccggcattgcttcatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggtatctacagctgtatccatggggtagccatagaggagcgc
caatccgtgatgaactcccccactgccaccatgaacaacacccactccaacatcctacgc
ttgctccgcacggccaagaacatggccaacctgtctggagtaaacggctcccctcagagt
gccctggacttcatccgccgagagtcctccgtctacgacatctctgagcatcgtcgcagc
ttcacgcattcagactgcaagtcttacaataacccaccctgtgaggaaaacctgttcagt
gactacattagcgaggtagagagaacatttggtaacctgcagctgaaggacagcaatgtg
taccaagaccactatcaccatcaccaccggccacacagcatcggcagcaccagctccatt
gatgggctctatgactgtgacaacccacccttcaccacccagcccaggtcaatcagcaag
aaacccctggacatcggcctgccctcctccaaacatagccagctcagcgacctgtatggc
aagttctctttcaagagtgaccgctacagtggccacgacgacttgattcgatcggatgtc
tccgacatctccacgcacactgtcacctatgggaacatcgagggcaacgcagccaagagg
aggaaacagcagtataaggacagtctaaagaagcggccagcctcggccaaatcgaggagg
gagtttgatgaaatcgagctggcctaccgtcgccgaccaccccgctccccggaccacaag
cgctacttcagggacaaagaagggctccgagacttctacctggaccagttccgaacaaag
gagaactcgcctcactgggagcacgtggacttgactgacatttacaaagaacgcagtgac
gacttcaagcgagattcggtcagtggaggtgggccctgtaccaacaggtctcacctcaaa
cacggaacgggcgagaagcacggagtggtaggcggggtgcctgctccttgggagaagaac
ctgaccaatgtggattgggaggaccggtctgggggcaacttctgccgcagctgtccttcc
aagctgcacaattactcctcgacggtggcagggcagaactcgggccggcaggcctgcatc
agatgtgaggcctgtaagaaggctggtaacctgtacgacatcagcaaggacaactccctg
caggaactggaccagccggctgcccccgtggctgtgacatccaacgcctccagcaccaag
taccctcaaagcccgactaattccaaggctcagaagaagaatcggaacaaactgcgccgg
cagcattcctacgacaccttcgtggacctgcagaaggaggaggccgccttggccccacgc
agcgtgagcctgaaagacaagggccgattcatggatgggagcccctacgcccatatgttt
gagatgccagctggtgagagctcctttgccaacaagtcctcagtgcccactgccggacac
caccacaacaaccccggcagcggctacatgctcagcaagtcgctctaccctgaccgggtc
acgcaaaaccctttcatccccacttttggggatgaccagtgcttgcttcacggcagcaaa
tcctacttcttcaggcagcccacggtggcaggggcgtcaaaaacaaggccggacttccgg
gcccttgtcaccaataagccagtggtgtcagcccttcatggggctgtgccaggtcgtttc
cagaaggacatttgtatagggaaccagtccaacccctgtgtgcctaacaacaaaaacccc
agggctttcaatggctccagcaatggacatgtttatgagaaactttctagtattgagtct
gatgtctga

DBGET integrated database retrieval system