KEGG   Rattus norvegicus (rat): 24414Help
Entry
24414             CDS       T01003                                 

Gene name
Grm1, Gprc1a
Definition
(RefSeq) glutamate receptor, metabotropic 1
  KO
K04603  
metabotropic glutamate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Long-term depression
Taste transduction
Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    24414 (Grm1)
   04020 Calcium signaling pathway
    24414 (Grm1)
   04072 Phospholipase D signaling pathway
    24414 (Grm1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24414 (Grm1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    24414 (Grm1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    24414 (Grm1)
  Nervous system
   04724 Glutamatergic synapse
    24414 (Grm1)
   04720 Long-term potentiation
    24414 (Grm1)
   04730 Long-term depression
    24414 (Grm1)
   04723 Retrograde endocannabinoid signaling
    24414 (Grm1)
  Sensory system
   04742 Taste transduction
    24414 (Grm1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24414 (Grm1)
G protein-coupled receptors [BR:rno04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    24414 (Grm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13
AA seq 1199 aa AA seqDB search
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGG
RQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEE
DNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQ
QPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQ
HLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTAS
KLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atggtccggctcctcttgattttcttcccaatgatctttttggagatgtccattttgccc
aggatgcctgacagaaaagtattgctggcaggtgcctcgtcccagcgctccgtggcgaga
atggacggagatgtcatcatcggagccctcttctcagtccatcaccagcctccagccgag
aaggtacccgaaaggaagtgtggggagatcagggaacagtatggtatccagagggtggag
gccatgttccacacgttggataagattaacgcggacccggtgctcctgcccaacatcact
ctgggcagtgagatccgggactcctgctggcactcttcagtggctctcgaacagagcatc
gaattcatcagagactccctgatttccatccgagatgagaaggatgggctgaaccgatgc
ctgcctgatggccagaccctgccccctggcaggactaagaagcctattgctggagtgatc
ggccctggctccagctctgtggccattcaagtccagaatcttctccagctgttcgacatc
ccacagatcgcctattctgccacaagcatagacctgagtgacaaaactttgtacaaatac
ttcctgagggtggtcccttctgacactttgcaggcaagggcgatgctcgacatagtcaag
cgttacaactggacctatgtctcagcagtccacacagaagggaattacggcgagagtgga
atggatgctttcaaagaactggctgcccaggaaggcctctgcatcgcacactcggacaaa
atctacagcaatgctggcgagaagagctttgaccggctcctgcgtaaactccgggagcgg
cttcccaaggccagggttgtggtctgcttctgcgagggcatgacagtgcggggcttactg
agtgccatgcgccgcctgggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcatcgaaggctatgaggtggaagccaacggagggatcacaata
aagcttcagtctccagaggtcaggtcatttgatgactacttcctgaagctgaggctggac
accaacacaaggaatccttggttccctgagttctggcaacatcgcttccagtgtcgccta
cctggacacctcttggaaaaccccaactttaagaaagtgtgcacaggaaatgaaagcttg
gaagaaaactatgtccaggacagcaaaatgggatttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgctctgtgtcccggccatgtgggcctgtgtgat
gctatgaaacccattgatggcaggaagctcctggatttcctcatcaaatcctcttttgtc
ggagtgtctggagaggaggtgtggttcgatgagaagggggatgctcccggaaggtatgac
attatgaatctgcagtacacagaagctaatcgctatgactatgtccacgtggggacctgg
catgaaggagtgctgaatattgatgattacaaaatccagatgaacaaaagcggaatggta
cgatctgtgtgcagtgagccttgcttaaagggtcagattaaggtcatacggaaaggagaa
gtgagctgctgctggatctgcacggcctgcaaagagaatgagtttgtgcaggacgagttc
acctgcagagcctgtgacctggggtggtggcccaacgcagagctcacaggctgtgagccc
attcctgtccgttatcttgagtggagtgacatagaatctatcatagccatcgccttttct
tgcctgggcatcctcgtgacgctgtttgtcaccctcatcttcgttctgtaccgggacaca
cccgtggtcaaatcctccagtagggagctctgctatatcattctggctggtattttcctc
ggctatgtgtgccctttcaccctcatcgccaaacctactaccacatcctgctacctccag
cgcctcctagttggcctctcttctgccatgtgctactctgctttagtgaccaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccagattc
atgagcgcttgggcccaagtgatcatagcctccattctgattagtgtacagctaacacta
gtggtgaccttgatcatcatggagcctcccatgcccattttgtcctacccgagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtagtggcccctgtgggttacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgccggccaac
ttcaatgaggctaaatacatcgccttcaccatgtacactacctgcatcatctggctggct
ttcgttcccatttactttgggagcaactacaagatcatcactacctgcttcgcggtgagc
ctcagtgtgacggtggccctggggtgcatgtttactccgaagatgtacatcatcattgcc
aaacctgagaggaacgtccgcagtgccttcacgacctctgatgttgtccgcatgcacgtc
ggtgatggcaaactgccgtgccgctccaacaccttcctcaacattttccggagaaagaag
cccggggcagggaatgccaattctaacggcaagtctgtgtcatggtctgaaccaggtgga
agacaggcgcccaagggacagcacgtgtggcagcgcctctctgtgcacgtgaagaccaac
gagacggcctgtaaccaaacagccgtaatcaaacccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagatgccagcaccaagaccctttacaatgtggaagaagag
gacaataccccttctgctcacttcagccctcccagcagcccttctatggtggtgcaccga
cgcgggccacccgtggccaccacaccacctctgccaccccatctgaccgcagaagagacc
cccctgttcctggctgattccgtcatccccaagggcttgcctcctcctctcccgcagcag
cagccacagcagccgccccctcagcagcccccgcagcagcccaagtccctgatggaccag
ctgcaaggcgtagtcaccaacttcggttcggggattccagatttccatgcggtgctggca
ggcccggggacaccaggaaacagcctgcgctctctgtacccgcccccgcctccgccgcaa
cacctgcagatgctgcccctgcacctgagcaccttccaggaggagtccatctcccctcct
ggggaggacatcgatgatgacagtgagagattcaagctcctgcaggagttcgtgtacgag
cgcgaagggaacaccgaagaagatgaattggaagaggaggaggacctgcccacagccagc
aagctgacccctgaggattctcctgccctgacgcctccttctcctttccgagattccgtg
gcctctggcagctcagtgcccagttcccccgtatctgagtcggtcctctgcacccctcca
aatgtaacctacgcctctgtcattctgagggactacaagcaaagctcttccaccctgtag

DBGET integrated database retrieval system