KEGG   Rattus norvegicus (rat): 24414Help
Entry
24414             CDS       T01003                                 

Gene name
Grm1, Gprc1a
Definition
(RefSeq) glutamate receptor, metabotropic 1
  KO
K04603  
metabotropic glutamate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Long-term depression
Taste transduction
Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    24414 (Grm1)
   04020 Calcium signaling pathway
    24414 (Grm1)
   04072 Phospholipase D signaling pathway
    24414 (Grm1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24414 (Grm1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    24414 (Grm1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    24414 (Grm1)
  Nervous system
   04724 Glutamatergic synapse
    24414 (Grm1)
   04720 Long-term potentiation
    24414 (Grm1)
   04730 Long-term depression
    24414 (Grm1)
   04723 Retrograde endocannabinoid signaling
    24414 (Grm1)
  Sensory system
   04742 Taste transduction
    24414 (Grm1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24414 (Grm1)
G protein-coupled receptors [BR:rno04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    24414 (Grm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13
AA seq 1199 aa AA seqDB search
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGG
RQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEE
DNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQ
QPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQ
HLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTAS
KLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atggtccggctcctcttgattttcttcccaatgatctttttggagatgtccattttgccc
aggatgcctgacagaaaagtattgctggcaggtgcctcgtcccagcgctccgtggcgaga
atggacggagatgtcatcatcggagccctcttctcagtccatcaccagcctccagccgag
aaggtacccgaaaggaagtgtggggagatcagggaacagtatggtatccagagggtggag
gccatgttccacacgttggataagattaacgcggacccggtgctcctgcccaacatcact
ctgggcagtgagatccgggactcctgctggcactcttcagtggctctcgaacagagcatc
gaattcatcagagactccctgatttccatccgagatgagaaggatgggctgaaccgatgc
ctgcctgatggccagaccctgccccctggcaggactaagaagcctattgctggagtgatc
ggccctggctccagctctgtggccattcaagtccagaatcttctccagctgttcgacatc
ccacagatcgcctattctgccacaagcatagacctgagtgacaaaactttgtacaaatac
ttcctgagggtggtcccttctgacactttgcaggcaagggcgatgctcgacatagtcaag
cgttacaactggacctatgtctcagcagtccacacagaagggaattacggcgagagtgga
atggatgctttcaaagaactggctgcccaggaaggcctctgcatcgcacactcggacaaa
atctacagcaatgctggcgagaagagctttgaccggctcctgcgtaaactccgggagcgg
cttcccaaggccagggttgtggtctgcttctgcgagggcatgacagtgcggggcttactg
agtgccatgcgccgcctgggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcatcgaaggctatgaggtggaagccaacggagggatcacaata
aagcttcagtctccagaggtcaggtcatttgatgactacttcctgaagctgaggctggac
accaacacaaggaatccttggttccctgagttctggcaacatcgcttccagtgtcgccta
cctggacacctcttggaaaaccccaactttaagaaagtgtgcacaggaaatgaaagcttg
gaagaaaactatgtccaggacagcaaaatgggatttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgctctgtgtcccggccatgtgggcctgtgtgat
gctatgaaacccattgatggcaggaagctcctggatttcctcatcaaatcctcttttgtc
ggagtgtctggagaggaggtgtggttcgatgagaagggggatgctcccggaaggtatgac
attatgaatctgcagtacacagaagctaatcgctatgactatgtccacgtggggacctgg
catgaaggagtgctgaatattgatgattacaaaatccagatgaacaaaagcggaatggta
cgatctgtgtgcagtgagccttgcttaaagggtcagattaaggtcatacggaaaggagaa
gtgagctgctgctggatctgcacggcctgcaaagagaatgagtttgtgcaggacgagttc
acctgcagagcctgtgacctggggtggtggcccaacgcagagctcacaggctgtgagccc
attcctgtccgttatcttgagtggagtgacatagaatctatcatagccatcgccttttct
tgcctgggcatcctcgtgacgctgtttgtcaccctcatcttcgttctgtaccgggacaca
cccgtggtcaaatcctccagtagggagctctgctatatcattctggctggtattttcctc
ggctatgtgtgccctttcaccctcatcgccaaacctactaccacatcctgctacctccag
cgcctcctagttggcctctcttctgccatgtgctactctgctttagtgaccaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccagattc
atgagcgcttgggcccaagtgatcatagcctccattctgattagtgtacagctaacacta
gtggtgaccttgatcatcatggagcctcccatgcccattttgtcctacccgagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtagtggcccctgtgggttacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgccggccaac
ttcaatgaggctaaatacatcgccttcaccatgtacactacctgcatcatctggctggct
ttcgttcccatttactttgggagcaactacaagatcatcactacctgcttcgcggtgagc
ctcagtgtgacggtggccctggggtgcatgtttactccgaagatgtacatcatcattgcc
aaacctgagaggaacgtccgcagtgccttcacgacctctgatgttgtccgcatgcacgtc
ggtgatggcaaactgccgtgccgctccaacaccttcctcaacattttccggagaaagaag
cccggggcagggaatgccaattctaacggcaagtctgtgtcatggtctgaaccaggtgga
agacaggcgcccaagggacagcacgtgtggcagcgcctctctgtgcacgtgaagaccaac
gagacggcctgtaaccaaacagccgtaatcaaacccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagatgccagcaccaagaccctttacaatgtggaagaagag
gacaataccccttctgctcacttcagccctcccagcagcccttctatggtggtgcaccga
cgcgggccacccgtggccaccacaccacctctgccaccccatctgaccgcagaagagacc
cccctgttcctggctgattccgtcatccccaagggcttgcctcctcctctcccgcagcag
cagccacagcagccgccccctcagcagcccccgcagcagcccaagtccctgatggaccag
ctgcaaggcgtagtcaccaacttcggttcggggattccagatttccatgcggtgctggca
ggcccggggacaccaggaaacagcctgcgctctctgtacccgcccccgcctccgccgcaa
cacctgcagatgctgcccctgcacctgagcaccttccaggaggagtccatctcccctcct
ggggaggacatcgatgatgacagtgagagattcaagctcctgcaggagttcgtgtacgag
cgcgaagggaacaccgaagaagatgaattggaagaggaggaggacctgcccacagccagc
aagctgacccctgaggattctcctgccctgacgcctccttctcctttccgagattccgtg
gcctctggcagctcagtgcccagttcccccgtatctgagtcggtcctctgcacccctcca
aatgtaacctacgcctctgtcattctgagggactacaagcaaagctcttccaccctgtag

DBGET integrated database retrieval system