KEGG   Rattus norvegicus (rat): 24494Help
Entry
24494             CDS       T01003                                 

Gene name
Il1b
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  
interleukin 1 beta
Organism
rno  Rattus norvegicus (rat)
Pathway
Antifolate resistance
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hematopoietic cell lineage
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Type I diabetes mellitus
Alzheimer's disease
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    24494 (Il1b)
   04064 NF-kappa B signaling pathway
    24494 (Il1b)
   04668 TNF signaling pathway
    24494 (Il1b)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24494 (Il1b)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    24494 (Il1b)
   04620 Toll-like receptor signaling pathway
    24494 (Il1b)
   04621 NOD-like receptor signaling pathway
    24494 (Il1b)
   04623 Cytosolic DNA-sensing pathway
    24494 (Il1b)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24494 (Il1b)
  Development
   04380 Osteoclast differentiation
    24494 (Il1b)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    24494 (Il1b)
   05321 Inflammatiory bowel disease (IBD)
    24494 (Il1b)
   05332 Graft-versus-host disease
    24494 (Il1b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24494 (Il1b)
   05020 Prion diseases
    24494 (Il1b)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    24494 (Il1b)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24494 (Il1b)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24494 (Il1b)
  Infectious diseases
   05132 Salmonella infection
    24494 (Il1b)
   05133 Pertussis
    24494 (Il1b)
   05134 Legionellosis
    24494 (Il1b)
   05152 Tuberculosis
    24494 (Il1b)
   05162 Measles
    24494 (Il1b)
   05164 Influenza A
    24494 (Il1b)
   05168 Herpes simplex infection
    24494 (Il1b)
   05146 Amoebiasis
    24494 (Il1b)
   05144 Malaria
    24494 (Il1b)
   05140 Leishmaniasis
    24494 (Il1b)
   05142 Chagas disease (American trypanosomiasis)
    24494 (Il1b)
   05143 African trypanosomiasis
    24494 (Il1b)
  Drug resistance
   01523 Antifolate resistance
    24494 (Il1b)
Cytokines [BR:rno04052]
 IL-1 family
  24494 (Il1b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   24494 (Il1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 268 aa AA seqDB search
MATVPELNCEIAAFDSEENDLFFEADRPQKIKDCFQALDLGCPDESIQLQISQQHLDKSF
RKAVSLIVAVEKLWQLPMSCPWSFQDEDPSTFFSFIFEEEPVLCDSWDDDDLLVCDVPIR
QLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKG
KNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYIST
SQAEHRPVFLGNSNGRDIVDFTMEPVSS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtccctgaactcaactgtgaaatagcagctttcgacagtgaggagaatgac
ctgttctttgaggctgacagaccccaaaagattaaggattgcttccaagcccttgacttg
ggctgtccagatgagagcatccagcttcaaatctcacagcagcatctcgacaagagcttc
aggaaggcagtgtcactcattgtggctgtggagaagctgtggcagctacctatgtcttgc
ccgtggagcttccaggatgaggacccaagcaccttcttttccttcatctttgaagaagag
cccgtcctctgtgactcgtgggatgatgacgacctgctagtgtgtgatgttcccattaga
cagctgcactgcaggcttcgagatgaacaacaaaaatgcctcgtgctgtctgacccatgt
gagctgaaagctctccacctcaatggacagaacataagccaacaagtggtattctccatg
agctttgtacaaggagagacaagcaacgacaaaatccctgtggccttgggcctcaagggg
aagaatctatacctgtcctgtgtgatgaaagacggcacacccaccctgcagctggagagt
gtggatcccaaacaatacccaaagaagaagatggaaaagcggtttgtcttcaacaagata
gaagtcaagaccaaagtggagtttgagtctgcacagttccccaactggtacatcagcacc
tctcaagcagagcacagacctgtcttcctaggaaacagcaatggtcgggacatagttgac
ttcaccatggaacccgtgtcttcctaa

DBGET integrated database retrieval system