KEGG   Rattus norvegicus (rat): 24516Help
Entry
24516             CDS       T01003                                 

Gene name
Jun
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  
transcription factor AP-1
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
cAMP signaling pathway
Apoptosis
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Cocaine addiction
Amphetamine addiction
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Renal cell carcinoma
Breast cancer
Choline metabolism in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    24516 (Jun)
   04012 ErbB signaling pathway
    24516 (Jun)
   04310 Wnt signaling pathway
    24516 (Jun)
   04668 TNF signaling pathway
    24516 (Jun)
   04024 cAMP signaling pathway
    24516 (Jun)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    24516 (Jun)
  Cellular community
   04510 Focal adhesion
    24516 (Jun)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    24516 (Jun)
   04660 T cell receptor signaling pathway
    24516 (Jun)
   04662 B cell receptor signaling pathway
    24516 (Jun)
  Endocrine system
   04912 GnRH signaling pathway
    24516 (Jun)
   04915 Estrogen signaling pathway
    24516 (Jun)
   04921 Oxytocin signaling pathway
    24516 (Jun)
  Nervous system
   04722 Neurotrophin signaling pathway
    24516 (Jun)
  Development
   04380 Osteoclast differentiation
    24516 (Jun)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24516 (Jun)
   05231 Choline metabolism in cancer
    24516 (Jun)
   05203 Viral carcinogenesis
    24516 (Jun)
   05210 Colorectal cancer
    24516 (Jun)
   05211 Renal cell carcinoma
    24516 (Jun)
   05224 Breast cancer
    24516 (Jun)
  Immune diseases
   05323 Rheumatoid arthritis
    24516 (Jun)
   05321 Inflammatiory bowel disease (IBD)
    24516 (Jun)
  Substance dependence
   05030 Cocaine addiction
    24516 (Jun)
   05031 Amphetamine addiction
    24516 (Jun)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24516 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24516 (Jun)
  Infectious diseases
   05132 Salmonella infection
    24516 (Jun)
   05133 Pertussis
    24516 (Jun)
   05166 HTLV-I infection
    24516 (Jun)
   05164 Influenza A
    24516 (Jun)
   05161 Hepatitis B
    24516 (Jun)
   05168 Herpes simplex infection
    24516 (Jun)
   05169 Epstein-Barr virus infection
    24516 (Jun)
   05140 Leishmaniasis
    24516 (Jun)
   05142 Chagas disease (American trypanosomiasis)
    24516 (Jun)
  Drug resistance
   01522 Endocrine resistance
    24516 (Jun)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    24516 (Jun)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q34.1
AA seq 334 aa AA seqDB search
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagtggcgcctacggctacagtaaccctaagattctgaagcagagcatgaccttg
aacctggccgacccggtgggcaatctgaagccgcacctccgagccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccactcagttcttgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgaaggcttcgtgcgcgccctagctgaa
ctgcatagccagaatacgctgcccagtgtcacctccgcggcacaacctgtcagtggggcg
ggcatggtcgctcccgctgtggcctcagtagctggcgctggcggcggcggcggctacagc
gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcgaccgggctggcctttccatcgcag
ccccagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggctgcaggcgctgaaggaagagccgcagacggtgccggagatgccggga
gagacgccgcccttgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagcggatc
gcccggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system