KEGG   Rattus norvegicus (rat): 24525Help
Entry
24525             CDS       T01003                                 

Gene name
Kras, Kras2, c-Ki-ras, p21
Definition
(RefSeq) Kirsten rat sarcoma viral oncogene
  KO
K07827  
GTPase KRas
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Dorso-ventral axis formation
Axon guidance
VEGF signaling pathway
Tight junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Alcoholism
Hepatitis C
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24525 (Kras)
   04015 Rap1 signaling pathway
    24525 (Kras)
   04010 MAPK signaling pathway
    24525 (Kras)
   04012 ErbB signaling pathway
    24525 (Kras)
   04370 VEGF signaling pathway
    24525 (Kras)
   04068 FoxO signaling pathway
    24525 (Kras)
   04072 Phospholipase D signaling pathway
    24525 (Kras)
   04071 Sphingolipid signaling pathway
    24525 (Kras)
   04151 PI3K-Akt signaling pathway
    24525 (Kras)
   04150 mTOR signaling pathway
    24525 (Kras)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    24525 (Kras)
  Cell growth and death
   04210 Apoptosis
    24525 (Kras)
  Cellular commiunity
   04530 Tight junction
    24525 (Kras)
   04540 Gap junction
    24525 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    24525 (Kras)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    24525 (Kras)
   04660 T cell receptor signaling pathway
    24525 (Kras)
   04662 B cell receptor signaling pathway
    24525 (Kras)
   04664 Fc epsilon RI signaling pathway
    24525 (Kras)
   04062 Chemokine signaling pathway
    24525 (Kras)
  Endocrine system
   04910 Insulin signaling pathway
    24525 (Kras)
   04912 GnRH signaling pathway
    24525 (Kras)
   04915 Estrogen signaling pathway
    24525 (Kras)
   04914 Progesterone-mediated oocyte maturation
    24525 (Kras)
   04917 Prolactin signaling pathway
    24525 (Kras)
   04921 Oxytocin signaling pathway
    24525 (Kras)
   04919 Thyroid hormone signaling pathway
    24525 (Kras)
   04916 Melanogenesis
    24525 (Kras)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24525 (Kras)
  Nervous system
   04725 Cholinergic synapse
    24525 (Kras)
   04726 Serotonergic synapse
    24525 (Kras)
   04720 Long-term potentiation
    24525 (Kras)
   04730 Long-term depression
    24525 (Kras)
   04722 Neurotrophin signaling pathway
    24525 (Kras)
  Development
   04320 Dorso-ventral axis formation
    24525 (Kras)
   04360 Axon guidance
    24525 (Kras)
  Aging
   04211 Longevity regulating pathway - mammal
    24525 (Kras)
   04213 Longevity regulating pathway - multiple species
    24525 (Kras)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24525 (Kras)
   05230 Central carbon metabolism in cancer
    24525 (Kras)
   05231 Choline metabolism in cancer
    24525 (Kras)
   05206 MicroRNAs in cancer
    24525 (Kras)
   05205 Proteoglycans in cancer
    24525 (Kras)
   05203 Viral carcinogenesis
    24525 (Kras)
   05210 Colorectal cancer
    24525 (Kras)
   05212 Pancreatic cancer
    24525 (Kras)
   05214 Glioma
    24525 (Kras)
   05216 Thyroid cancer
    24525 (Kras)
   05221 Acute myeloid leukemia
    24525 (Kras)
   05220 Chronic myeloid leukemia
    24525 (Kras)
   05218 Melanoma
    24525 (Kras)
   05211 Renal cell carcinoma
    24525 (Kras)
   05219 Bladder cancer
    24525 (Kras)
   05215 Prostate cancer
    24525 (Kras)
   05213 Endometrial cancer
    24525 (Kras)
   05223 Non-small cell lung cancer
    24525 (Kras)
  Substance dependence
   05034 Alcoholism
    24525 (Kras)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    24525 (Kras)
  Infectious diseases
   05166 HTLV-I infection
    24525 (Kras)
   05161 Hepatitis B
    24525 (Kras)
   05160 Hepatitis C
    24525 (Kras)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    24525 (Kras)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    24525 (Kras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q44
AA seq 188 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SRTRCIVM
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctagtagggaataagtgtgacttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttatgggattcca
ttcattgagacctcagcgaagacaagacagggtgttgacgatgccttctatacattagtc
cgagaaattcgaaaacataaagaaaagatgagcaaagatgggaaaaagaagaagaagaag
tcaaggacaaggtgtatagtcatgtga

DBGET integrated database retrieval system