KEGG   Rattus norvegicus (rat): 24525Help
Entry
24525             CDS       T01003                                 

Gene name
Kras, Kras2, c-Ki-ras, p21
Definition
(RefSeq) KRAS proto-oncogene, GTPase
  KO
K07827  GTPase KRas
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04960  Aldosterone-regulated sodium reabsorption
rno05034  Alcoholism
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05165  Human papillomavirus infection
rno05166  HTLV-I infection
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24525 (Kras)
   04015 Rap1 signaling pathway
    24525 (Kras)
   04010 MAPK signaling pathway
    24525 (Kras)
   04012 ErbB signaling pathway
    24525 (Kras)
   04370 VEGF signaling pathway
    24525 (Kras)
   04371 Apelin signaling pathway
    24525 (Kras)
   04068 FoxO signaling pathway
    24525 (Kras)
   04072 Phospholipase D signaling pathway
    24525 (Kras)
   04071 Sphingolipid signaling pathway
    24525 (Kras)
   04151 PI3K-Akt signaling pathway
    24525 (Kras)
   04150 mTOR signaling pathway
    24525 (Kras)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    24525 (Kras)
   04137 Mitophagy - animal
    24525 (Kras)
  Cell growth and death
   04210 Apoptosis
    24525 (Kras)
   04218 Cellular senescence
    24525 (Kras)
  Cellular community - eukaryotes
   04540 Gap junction
    24525 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    24525 (Kras)
  Cell motility
   04810 Regulation of actin cytoskeleton
    24525 (Kras)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    24525 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    24525 (Kras)
   04660 T cell receptor signaling pathway
    24525 (Kras)
   04662 B cell receptor signaling pathway
    24525 (Kras)
   04664 Fc epsilon RI signaling pathway
    24525 (Kras)
   04062 Chemokine signaling pathway
    24525 (Kras)
  Endocrine system
   04910 Insulin signaling pathway
    24525 (Kras)
   04912 GnRH signaling pathway
    24525 (Kras)
   04915 Estrogen signaling pathway
    24525 (Kras)
   04914 Progesterone-mediated oocyte maturation
    24525 (Kras)
   04917 Prolactin signaling pathway
    24525 (Kras)
   04921 Oxytocin signaling pathway
    24525 (Kras)
   04926 Relaxin signaling pathway
    24525 (Kras)
   04919 Thyroid hormone signaling pathway
    24525 (Kras)
   04916 Melanogenesis
    24525 (Kras)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24525 (Kras)
  Nervous system
   04725 Cholinergic synapse
    24525 (Kras)
   04726 Serotonergic synapse
    24525 (Kras)
   04720 Long-term potentiation
    24525 (Kras)
   04730 Long-term depression
    24525 (Kras)
   04722 Neurotrophin signaling pathway
    24525 (Kras)
  Development
   04360 Axon guidance
    24525 (Kras)
  Aging
   04211 Longevity regulating pathway - mammal
    24525 (Kras)
   04213 Longevity regulating pathway - multiple species
    24525 (Kras)
  Environmental adaptation
   04714 Thermogenesis
    24525 (Kras)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24525 (Kras)
   05230 Central carbon metabolism in cancer
    24525 (Kras)
   05231 Choline metabolism in cancer
    24525 (Kras)
   05206 MicroRNAs in cancer
    24525 (Kras)
   05205 Proteoglycans in cancer
    24525 (Kras)
   05203 Viral carcinogenesis
    24525 (Kras)
   05210 Colorectal cancer
    24525 (Kras)
   05212 Pancreatic cancer
    24525 (Kras)
   05225 Hepatocellular carcinoma
    24525 (Kras)
   05226 Gastric cancer
    24525 (Kras)
   05214 Glioma
    24525 (Kras)
   05216 Thyroid cancer
    24525 (Kras)
   05221 Acute myeloid leukemia
    24525 (Kras)
   05220 Chronic myeloid leukemia
    24525 (Kras)
   05218 Melanoma
    24525 (Kras)
   05211 Renal cell carcinoma
    24525 (Kras)
   05219 Bladder cancer
    24525 (Kras)
   05215 Prostate cancer
    24525 (Kras)
   05213 Endometrial cancer
    24525 (Kras)
   05224 Breast cancer
    24525 (Kras)
   05223 Non-small cell lung cancer
    24525 (Kras)
  Substance dependence
   05034 Alcoholism
    24525 (Kras)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    24525 (Kras)
  Infectious diseases
   05166 HTLV-I infection
    24525 (Kras)
   05161 Hepatitis B
    24525 (Kras)
   05160 Hepatitis C
    24525 (Kras)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    24525 (Kras)
   05165 Human papillomavirus infection
    24525 (Kras)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    24525 (Kras)
   01522 Endocrine resistance
    24525 (Kras)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    24525 (Kras)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    24525 (Kras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ArgK FeoB_N G-alpha ATP_bind_1 Septin ParA CbiA AAA_25
Motif
Other DBs
NCBI-GeneID: 24525
NCBI-ProteinID: NP_113703
RGD: 2981
Ensembl: ENSRNOG00000009338
UniProt: P08644 A0JN17
Position
4q44
AA seq 188 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SRTRCIVM
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctagtagggaataagtgtgacttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttatgggattcca
ttcattgagacctcagcgaagacaagacagggtgttgacgatgccttctatacattagtc
cgagaaattcgaaaacataaagaaaagatgagcaaagatgggaaaaagaagaagaagaag
tcaaggacaaggtgtatagtcatgtga

DBGET integrated database retrieval system