KEGG   Rattus norvegicus (rat): 24539Help
Entry
24539             CDS       T01003                                 

Gene name
Lpl
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    24539 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    24539 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24539 (Lpl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     24539 (Lpl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   24539 (Lpl)
  Exosomal proteins of breast milk
   24539 (Lpl)
Heparan sulfate/heparin binding proteins [BR:rno00536]
 Enzymes (General comment) Variety
  24539 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16p14
AA seq 474 aa AA seqDB search
MESKALLLVALGVWLQSLTAFRGGVAAADGGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTENDKQNNQ
AFEISLYGTVAESENIPFTLPEVATNKTYSFLIYTEVDIGELLMMKLKWKNDSYFRWSDW
WSSPSFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDAAVFVKCHDKSLKKSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggccctgggagtttggctccagagtttgaccgcc
ttccgcggaggggtggccgcagcagacgggggaagagatttctcagacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctgattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaaaacctttgtggtgatccat
ggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgtggctgccctatac
aaaagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtctgccggctataccaagctggtgggaaatgatgtggccaggttcatcaac
tggttggaggaagaatttaactaccccctagacaatgtccacctcttagggtacagtctt
ggagcccatgctgctggcgtggcaggaagtctgaccaacaagaaggtcaatagaattact
ggcttggatccagctgggcctaactttgagtatgcagaagcccctagtcgcctttctcct
gatgatgcggatttcgtagatgtcttacacacatttaccagggggtcgcctggtcgaagt
attgggatccagaaaccagtagggcatgttgatatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccattcgtgtaattgcagagaaggggcttggagatgtg
gaccagctggtgaagtgctcgcacgagcgctccatccatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaattccaaggaggcatttgagaaaggg
ctctgcctgagttgcagaaagaatcgctgtaacaacgtgggctatgagatcaacaaggtc
agagccaagagaagcagtaagatgtacctgaagactcgctctcagatgccctacaaagta
ttccattaccaagtcaagattcacttttctggaactgagaatgacaagcaaaacaaccag
gccttcgagatttctctgtatggcacagtggctgaaagtgagaacattcccttcaccctg
ccggaggtcgccacaaataaaacctactccttcttgatttacacggaggtggacatcggg
gaattgctgatgatgaagcttaagtggaagaacgactcctacttccgctggtcagactgg
tggagcagtcccagctttgtcatcgagaagatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgccagggagaaagtttctcatctgcagaaaggaaaggacgctgca
gtgtttgtgaaatgccatgacaagtctctgaagaagtcgggctga

DBGET integrated database retrieval system