KEGG   Rattus norvegicus (rat): 24539Help
Entry
24539             CDS       T01003                                 

Gene name
Lpl
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    24539 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    24539 (Lpl)
  Digestive system
   04979 Cholesterol metabolism
    24539 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24539 (Lpl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     24539 (Lpl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   24539 (Lpl)
  Exosomal proteins of breast milk
   24539 (Lpl)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   24539 (Lpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  24539 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 24539
NCBI-ProteinID: NP_036730
RGD: 3017
Ensembl: ENSRNOG00000012181
UniProt: Q06000
Position
16p14
AA seq 474 aa AA seqDB search
MESKALLLVALGVWLQSLTAFRGGVAAADGGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTENDKQNNQ
AFEISLYGTVAESENIPFTLPEVATNKTYSFLIYTEVDIGELLMMKLKWKNDSYFRWSDW
WSSPSFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDAAVFVKCHDKSLKKSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggccctgggagtttggctccagagtttgaccgcc
ttccgcggaggggtggccgcagcagacgggggaagagatttctcagacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctgattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaaaacctttgtggtgatccat
ggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgtggctgccctatac
aaaagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtctgccggctataccaagctggtgggaaatgatgtggccaggttcatcaac
tggttggaggaagaatttaactaccccctagacaatgtccacctcttagggtacagtctt
ggagcccatgctgctggcgtggcaggaagtctgaccaacaagaaggtcaatagaattact
ggcttggatccagctgggcctaactttgagtatgcagaagcccctagtcgcctttctcct
gatgatgcggatttcgtagatgtcttacacacatttaccagggggtcgcctggtcgaagt
attgggatccagaaaccagtagggcatgttgatatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccattcgtgtaattgcagagaaggggcttggagatgtg
gaccagctggtgaagtgctcgcacgagcgctccatccatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaattccaaggaggcatttgagaaaggg
ctctgcctgagttgcagaaagaatcgctgtaacaacgtgggctatgagatcaacaaggtc
agagccaagagaagcagtaagatgtacctgaagactcgctctcagatgccctacaaagta
ttccattaccaagtcaagattcacttttctggaactgagaatgacaagcaaaacaaccag
gccttcgagatttctctgtatggcacagtggctgaaagtgagaacattcccttcaccctg
ccggaggtcgccacaaataaaacctactccttcttgatttacacggaggtggacatcggg
gaattgctgatgatgaagcttaagtggaagaacgactcctacttccgctggtcagactgg
tggagcagtcccagctttgtcatcgagaagatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgccagggagaaagtttctcatctgcagaaaggaaaggacgctgca
gtgtttgtgaaatgccatgacaagtctctgaagaagtcgggctga

DBGET integrated database retrieval system