KEGG   Rattus norvegicus (rat): 24539Help
Entry
24539             CDS       T01003                                 

Gene name
Lpl
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rno00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:rno03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:rno05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16p14
AA seq 474 aa AA seqDB search
MESKALLLVALGVWLQSLTAFRGGVAAADGGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTENDKQNNQ
AFEISLYGTVAESENIPFTLPEVATNKTYSFLIYTEVDIGELLMMKLKWKNDSYFRWSDW
WSSPSFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDAAVFVKCHDKSLKKSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggccctgggagtttggctccagagtttgaccgcc
ttccgcggaggggtggccgcagcagacgggggaagagatttctcagacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctgattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaaaacctttgtggtgatccat
ggatggacggtgacaggaatgtatgagagttgggtgcccaaacttgtggctgccctatac
aaaagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtctgccggctataccaagctggtgggaaatgatgtggccaggttcatcaac
tggttggaggaagaatttaactaccccctagacaatgtccacctcttagggtacagtctt
ggagcccatgctgctggcgtggcaggaagtctgaccaacaagaaggtcaatagaattact
ggcttggatccagctgggcctaactttgagtatgcagaagcccctagtcgcctttctcct
gatgatgcggatttcgtagatgtcttacacacatttaccagggggtcgcctggtcgaagt
attgggatccagaaaccagtagggcatgttgatatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccattcgtgtaattgcagagaaggggcttggagatgtg
gaccagctggtgaagtgctcgcacgagcgctccatccatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaattccaaggaggcatttgagaaaggg
ctctgcctgagttgcagaaagaatcgctgtaacaacgtgggctatgagatcaacaaggtc
agagccaagagaagcagtaagatgtacctgaagactcgctctcagatgccctacaaagta
ttccattaccaagtcaagattcacttttctggaactgagaatgacaagcaaaacaaccag
gccttcgagatttctctgtatggcacagtggctgaaagtgagaacattcccttcaccctg
ccggaggtcgccacaaataaaacctactccttcttgatttacacggaggtggacatcggg
gaattgctgatgatgaagcttaagtggaagaacgactcctacttccgctggtcagactgg
tggagcagtcccagctttgtcatcgagaagatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgccagggagaaagtttctcatctgcagaaaggaaaggacgctgca
gtgtttgtgaaatgccatgacaagtctctgaagaagtcgggctga

DBGET integrated database retrieval system