KEGG   Rattus norvegicus (rat): 24559Help
Entry
24559             CDS       T01003                                 

Gene name
Mos
Definition
Moloney sarcoma oncogene (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    24559 (Mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    24559 (Mos)
  Cell growth and death
   04114 Oocyte meiosis
    24559 (Mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    24559 (Mos)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     24559 (Mos)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  MOS family
   24559 (Mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q12
AA seq 342 aa AA seqDB search
MPSPLILCRYLPRELSPTVDSRSCSSPLVASRKAGKFLGATPPRAPRLSRRLAWCFIDWG
QVCLLHRLGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRSFWAELNIARLHHDNIV
RVVAASTRTPEGSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLD
IVNGLLFLHSQSILHLDLKPANILISEKDVCKISDFGCSQKLQDLRCRQASLHHIGGTYT
HQAPELLKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAVF
TASLTGKTLQNIVQSCWEARALQRPGAELLQKDLKAFRGALG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcctctcatcctgtgtcgctacctccctcgcgagctgtcgccaacggtggac
tcgaggtcctgcagcagccccttggtggcctcgaggaaggcggggaagttcctgggggcc
actcctcctcgggccccgcggctgtcacgccggctggcctggtgcttcatagactgggga
caggtatgcctgctgcataggctgggttctggagggtttggctcggtgtacaaagccact
taccacggtgttcctgtggccatcaagcaagtgaacaagtgcaccaggaacctacgtgca
tcccagcggagtttctgggctgaactgaacattgcaaggctgcaccacgacaacatagtc
cgggttgtggctgccagcacgcgcacgccggaaggttccaacagccttggtaccataatc
atggagtttgggggcaatgtgactctacaccaagtcatctacggtgccacccgctcccca
gagcctctcagctgcagagagcaactgagtttgggaaagtgcctcaagtattccctagat
attgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaagcca
gcgaacattttgatcagtgagaaggacgtttgtaagataagtgacttcggctgctcccag
aagcttcaggatctgcggtgccggcaggcgtcccttcaccacatcgggggcacgtacacg
caccaagctccggagctcctgaaaggagagatcgccacgcccaaagccgacatctactct
tttggcatcaccctgtggcagatgaccaccagggaggtgccttactccggcgagcctcag
tacgtgcagtacgcagtggtagcctacaatctgcgcccgtcactggcaggggcggtgttc
accgcctccctgactgggaagacgctgcagaacatcgtccagagctgctgggaggcccgc
gccctgcagaggccgggtgcagaactgctccagaaggacctgaaggctttccgaggggca
ctgggctga

DBGET integrated database retrieval system