KEGG   Rattus norvegicus (rat): 24559Help
Entry
24559             CDS       T01003                                 

Gene name
Mos
Definition
Moloney sarcoma oncogene (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:rno04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:rno04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:rno04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
5q12
AA seq 342 aa AA seqDB search
MPSPLILCRYLPRELSPTVDSRSCSSPLVASRKAGKFLGATPPRAPRLSRRLAWCFIDWG
QVCLLHRLGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRSFWAELNIARLHHDNIV
RVVAASTRTPEGSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLD
IVNGLLFLHSQSILHLDLKPANILISEKDVCKISDFGCSQKLQDLRCRQASLHHIGGTYT
HQAPELLKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAVF
TASLTGKTLQNIVQSCWEARALQRPGAELLQKDLKAFRGALG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcctctcatcctgtgtcgctacctccctcgcgagctgtcgccaacggtggac
tcgaggtcctgcagcagccccttggtggcctcgaggaaggcggggaagttcctgggggcc
actcctcctcgggccccgcggctgtcacgccggctggcctggtgcttcatagactgggga
caggtatgcctgctgcataggctgggttctggagggtttggctcggtgtacaaagccact
taccacggtgttcctgtggccatcaagcaagtgaacaagtgcaccaggaacctacgtgca
tcccagcggagtttctgggctgaactgaacattgcaaggctgcaccacgacaacatagtc
cgggttgtggctgccagcacgcgcacgccggaaggttccaacagccttggtaccataatc
atggagtttgggggcaatgtgactctacaccaagtcatctacggtgccacccgctcccca
gagcctctcagctgcagagagcaactgagtttgggaaagtgcctcaagtattccctagat
attgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaagcca
gcgaacattttgatcagtgagaaggacgtttgtaagataagtgacttcggctgctcccag
aagcttcaggatctgcggtgccggcaggcgtcccttcaccacatcgggggcacgtacacg
caccaagctccggagctcctgaaaggagagatcgccacgcccaaagccgacatctactct
tttggcatcaccctgtggcagatgaccaccagggaggtgccttactccggcgagcctcag
tacgtgcagtacgcagtggtagcctacaatctgcgcccgtcactggcaggggcggtgttc
accgcctccctgactgggaagacgctgcagaacatcgtccagagctgctgggaggcccgc
gccctgcagaggccgggtgcagaactgctccagaaggacctgaaggctttccgaggggca
ctgggctga

DBGET integrated database retrieval system