KEGG   Rattus norvegicus (rat): 24586Help
Entry
24586             CDS       T01003                                 

Gene name
Ncam1, Cd56, N-CAM, N-CAM-1, NCAM-1, NCAM-C, NCAMC, Ncam
Definition
(RefSeq) neural cell adhesion molecule 1
  KO
K06491  
neural cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell adhesion molecules (CAMs)
Prion diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    24586 (Ncam1)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    24586 (Ncam1)
Cell adhesion molecules and their ligands [BR:rno04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     24586 (Ncam1)
   5/3 subfamily
    ROBO3; roundabout, axon guidance receptor 3 [KO:K06755]
     24586 (Ncam1)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     24586 (Ncam1)
   6/4 subfamily
    CNTN2; contactin 2 [KO:K06760]
     24586 (Ncam1)
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     24586 (Ncam1)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     24586 (Ncam1)
 4. Link Protein Family
  NCAN, CSPG3; neurocan core protein [KO:K06794]
   24586 (Ncam1)
Cellular antigens [BR:rno04090]
 Proteins
  24586 (Ncam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   24586 (Ncam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  24586 (Ncam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23
AA seq 858 aa AA seqDB search
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMF
KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGF
PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDAS
IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRP
EKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQ
GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD
SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVP
ILKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGLGEISA
ATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRALASEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGLS
TGAIVGILIVIFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVETKSEPQESEAKPAPTE
VKTVPNEATQTKENESKA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaactaaggatctcatctggactttgtttttcctgggaactgcagtttccctg
caggtagatattgttcccagccaaggagaaatcagcgttggagagtccaaattcttcctg
tgtcaagtggcaggagatgccaaagataaggacatctcctggttctcccccaacggggag
aaactgagcccaaaccagcagcggatctcagtggtgtggaacgatgatgactcctctacc
ctcaccatctacaacgccaacattgatgatgccggcatttacaagtgcgtggtcaccgct
gaagacggcacccagtccgaggccactgtcaatgtgaagatcttccagaagctcatgttc
aagaatgcgccaaccccacaggagtttaaggaaggggaagatgctgtgattgtctgtgat
gtggtcagctctctgcccccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccggttcatagtcctatccaacaactacctgcagatccgaggcatcaag
aaaacagatgagggcacttaccgctgtgaaggcaggatcctggcccggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtaccacccactgtccaggccagacagagcatc
gtgaatgccactgccaacctgggccagtctgtcaccctggtgtgtgatgccgatggcttc
ccagagcccaccatgagctggacaaaggatggggaacccatagagaatgaggaggaagat
gacgagaagcacatcttcagtgacgacagttcggagctgaccatcaggaatgtggacaaa
aatgacgaagccgaatacgtctgcatcgctgagaacaaggctggcgagcaggatgcctcc
atccacctcaaggtcttcgcaaagcccaaaatcacctatgtagagaatcagacagccatg
gaactagaggagcaagtcactctgacatgtgaagcctccggagaccccattccttccatc
acctggagaacgtccacccgaaacatcagcagtgaagaaaaggcatcgtggactcgacca
gagaagcaagagactctagatgggcacatggtggtacgcagccatgctcgtgtgtcctcc
ctgaccctgaagagcatccagtacacagatgctggagaatacatctgcactgccagcaac
accatcggccaggactcccagtccatgtaccttgaagttcaatatgctcccaagctccag
ggccctgtagctgtgtacacttgggaagggaaccaggtgaacatcacctgtgaggtcttt
gcctacccaagtgccacaatctcctggttccgagatggccagttgctgccaagctccaac
tacagcaatatcaagatctacaacaccccatctgcgagctatctggaggtaacccctgat
tccgaaaatgactttggaaactacaactgcacagcggtgaaccgtattggacaggagtcc
ttggaattcatcctggttcaagcagatacaccatcttccccatccatcgaccgggtggaa
ccatactccagcacagcacaggtacaatttgatgagccagaagccacaggtggagttccc
atcctcaaatacaaggctgagtggaagtcgctgggtgaagaagcatggcattccaagtgg
tatgatgccaaagaagccaacatggaagggattgtcaccatcatgggcctgaagcctgag
acaaggtacgcggtacgactggcggccctcaacggcaaggggctgggcgagatcagtgca
gccactgagttcaagacacagccagtccgggaacccagcgcacccaagctggaagggcag
atgggagaggacgggaactccatcaaggtgaacctgatcaagcaggatgacggcggctcc
cccatcagacactatctggtcaagtacagagcgctcgcctccgagtggaaaccagagatc
aggctcccgtccggcagtgaccacgtcatgctcaagtccctagactggaacgccgagtac
gaagtatatgtggtagctgagaaccagcaaggaaaatccaaggcagctcacttcgtgttc
aggacttcagcccagcccacggccatcccagccaatggcagccccactgcaggcctgagc
acaggcgccattgtgggcatcctcattgtcattttcgtcctactcctggtggtcatggac
atcacctgctacttcctgaacaagtgtggcctgctcatgtgcatcgctgttaacctgtgc
ggcaaagcggggcccggagccaagggcaaagacatggaggagggcaaggctgctttctcg
aaagatgagtctaaagaacccattgtagaggtccgaacggaggaggaacggactccaaac
catgacggagggaagcacacagagcccaacgagaccacaccactgacagagcccgagaag
ggtcctgtagaaacaaagtccgagccccaggagtcagaagcaaagccagcgccaactgaa
gtcaagacggtccccaatgaagccacacaaacgaaagagaatgagagcaaagcatga

DBGET integrated database retrieval system