KEGG   Rattus norvegicus (rat): 24600Help
Entry
24600             CDS       T01003                                 

Gene name
Nos3, eNos
Definition
(RefSeq) nitric oxide synthase 3 (EC:1.14.13.39)
  KO
K13242  
nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
Sphingolipid signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Platelet activation
Estrogen signaling pathway
Oxytocin signaling pathway
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    24600 (Nos3)
   00330 Arginine and proline metabolism
    24600 (Nos3)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    24600 (Nos3)
   04066 HIF-1 signaling pathway
    24600 (Nos3)
   04020 Calcium signaling pathway
    24600 (Nos3)
   04071 Sphingolipid signaling pathway
    24600 (Nos3)
   04022 cGMP - PKG signaling pathway
    24600 (Nos3)
   04151 PI3K-Akt signaling pathway
    24600 (Nos3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    24600 (Nos3)
  Endocrine system
   04915 Estrogen signaling pathway
    24600 (Nos3)
   04921 Oxytocin signaling pathway
    24600 (Nos3)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    24600 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24600 (Nos3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24600 (Nos3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q11
AA seq 1202 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPVPPSPTRPAPDHSPPLTR
PPDGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVVATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRYAGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLYSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGSQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSTEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLA
YRTQDVLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGSMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPTQETP
GS
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctagggctcggg
ctgggcctagggctatgcggcaagcagggcccagcctcaccggcaccagagcctagccag
gcaccagtacccccgtccccaacccgaccagcaccagaccacagccccccgttaacccgg
cccccagacggacccaagtttcctcgagtaaagaactgggaagtgggcagcatcacctac
gataccctcagtgcacaggctcagcaggatgggccctgtaccccaagacgctgcttggga
tccctggtatttccaaggaagttacagagccggcccacccagggcccttcacccactgag
cagctattgggtcaagcccgggacttcatcaatcagtactataactcgatcaaaaggagt
ggttcccaggctcatgagcagcggcttcaggaagtggaagctgaggtggtggccacgggc
acctaccagctccgggagagtgagctggtgtttggggccaaacaggcctggcgcaacgct
ccccgctgtgtggggcggatccagtgggggaaactgcaggtatttgatgctcgggactgc
aggacagcacaggaaatgttcacctacatctgtaaccacattaagtatgcaacaaaccga
ggcaatcttcgttcagccatcacggtgttcccccagcgctacgctggccggggagacttc
cggatctggaacagccagctggtgcgctacgcgggctataggcagcaggacggctctgtg
cgaggggaccctgccaacgtggagatcactgagctctgtattcaacatggctggacccca
ggaaatggccgctttgatgtgctgcccctgctactccaggctcccgatgagcccccagaa
ctcttcactctgcccccagagctggtcctcgaggtgcctctggagcaccccacgctagag
tggtttgctgcccttggcctgcgctggtatgccctcccagctgtgtccaatatgctgcta
gaaatcgggggcctggagtttccggctgcccctttcagcggctggtacatgagttcagag
attggcatgagggacctgtgtgaccctcaccgatacaacatacttgaggatgtggctgtc
tgcatggatctagacacccggacaacctcatcactgtggaaagacaaggcagcagtggaa
attaacgtggctgtgctgtacagttaccagctggccaaagtgaccattgtggaccaccat
gccgccacagcctccttcatgaagcacttggaaaatgagcagaaggccagagggggctgc
cccgctgactgggcctggatcgtgccccccatctcaggcagcctcacccctgtcttccat
caagagatggtcaactatttcctgtcccctgccttccgctaccagcctgacccctggaaa
ggaagtgcagcaaaaggcacaggcatcaccaggaagaagacttttaaggaagtagccaat
gcagtgaagatctctgcctcactcatgggcacggtgatggcgaagcgtgtgaaggcgact
atcctgtatggctctgagactggccgcgcccagagctacgcacagcagctggggaggctc
tttcggaaggcgtttgacccccgggtcctgtgcatggatgaatacgatgtggtatcccta
gagcatgaggccttggtattggtggtgaccagcacatttggcaatggggatcccccggag
aatggagagagctttgcagcagcgctgatggaaatgtcgggcccctacaacagctcccct
cggcctgagcagcacaagagttacaaaatccgattcaacagtgtctcctgctcggaccca
ctggtatcctcttggcggcgcaaaaggaaggaatccagtaacacagacagtgcaggggcc
ctgggcaccctcaggttctgtgtgtttgggctgggctccagagcatacccgcacttctgt
gcctttgctcgagcggtggacacaaggctggaggagctgggcggggagcgactgttgcag
ctgggccagggtgatgagctctgcggccaggaggaggctttccgaggctgggcccaggca
gccttccaggctgcctgtgaaactttctgtgtgggagaagatgccaaggctgctgcccga
gatatcttcagtcccaagcgcagctggaaacgccagaggtaccggctgagtacccaagct
gagagcctgcaattactgccagggctgactcacgtgcacagacggaagatgttccaggct
acaattctttctgtggagaacctacagagcagcaaatccacccgagccacaatcctggtg
cgtctggacactggaagccaggagggactgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccggcctggcctagtggaggcgctgctgagccgagtggaggaccctccg
ccatccacagagcctgtggccgtggaacaactggaaaaaggcagccctggtggccctccc
cccggctgggtacgggacccccggcttcccccatgtacgctgcgccaggctctcacttac
ttcctggacatcacttccccgcccagccctcgccttcttcgactgctgagcaccctggca
gaggagtccagcgaacagcaggagctagaggctcttagccaggacccccggcgctacgaa
gaatggaagtggttccgctgccccacactgctagaggtgctggaacaatttccatccgtg
gcactgcctgccccgctgatcctcacccagctgcccctgctccagccccggtactactct
gtcagctcagcacccagcgcccacccaggagagatccacctcactgtagctgtgctggca
tacagaacccaggatgtgctgggccctctgcactatggggtctgttccacatggatgagc
caactcaaggcaggagacccggtgccctgcttcatcaggggggctccctccttccggctg
ccacctgatcctaacttgccttgcatcctggtgggcccagggactggtattgcacccttc
cggggattctggcaagaccgattacacgacattgagatcaaaggactgcagcctgccccc
atgactttggtgtttggctgccgatgctcccaactggaccatctctaccgggacgaggta
ctggacgcccagcagcgtggagtgtttggacaagtcctcaccgccttttccagggatcct
ggcagccctaagacctatgtgcaagacctcctgaggacagagctggccgcggaggttcac
cgcgtgctgtgcctcgagcaaggacacatgtttgtctgcggtgatgtcactatggcaacc
agcgtcctgcaaaccgtgcagcgaattctggcaacagagggcagcatggagctggatgaa
gccggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttcgga
ctcacattgcgcacccaggaggtgacgagccgcatccgcacccagagtttttctttgcag
gagcgacagctgaggggtgcagtgccctggtcctttgacccgcctacccaagaaacacct
ggttcctga

DBGET integrated database retrieval system