KEGG   Rattus norvegicus (rat): 24605Help
Entry
24605             CDS       T01003                                 

Gene name
Nras
Definition
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  
GTPase NRas
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Axon guidance
VEGF signaling pathway
Tight junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Alcoholism
Hepatitis C
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24605 (Nras)
   04015 Rap1 signaling pathway
    24605 (Nras)
   04010 MAPK signaling pathway
    24605 (Nras)
   04012 ErbB signaling pathway
    24605 (Nras)
   04370 VEGF signaling pathway
    24605 (Nras)
   04068 FoxO signaling pathway
    24605 (Nras)
   04072 Phospholipase D signaling pathway
    24605 (Nras)
   04071 Sphingolipid signaling pathway
    24605 (Nras)
   04151 PI3K-Akt signaling pathway
    24605 (Nras)
   04150 mTOR signaling pathway
    24605 (Nras)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    24605 (Nras)
  Cell growth and death
   04210 Apoptosis
    24605 (Nras)
  Cellular community
   04530 Tight junction
    24605 (Nras)
   04540 Gap junction
    24605 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    24605 (Nras)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    24605 (Nras)
   04660 T cell receptor signaling pathway
    24605 (Nras)
   04662 B cell receptor signaling pathway
    24605 (Nras)
   04664 Fc epsilon RI signaling pathway
    24605 (Nras)
   04062 Chemokine signaling pathway
    24605 (Nras)
  Endocrine system
   04910 Insulin signaling pathway
    24605 (Nras)
   04912 GnRH signaling pathway
    24605 (Nras)
   04915 Estrogen signaling pathway
    24605 (Nras)
   04917 Prolactin signaling pathway
    24605 (Nras)
   04921 Oxytocin signaling pathway
    24605 (Nras)
   04919 Thyroid hormone signaling pathway
    24605 (Nras)
   04916 Melanogenesis
    24605 (Nras)
  Nervous system
   04725 Cholinergic synapse
    24605 (Nras)
   04726 Serotonergic synapse
    24605 (Nras)
   04720 Long-term potentiation
    24605 (Nras)
   04730 Long-term depression
    24605 (Nras)
   04722 Neurotrophin signaling pathway
    24605 (Nras)
  Development
   04360 Axon guidance
    24605 (Nras)
  Aging
   04211 Longevity regulating pathway - mammal
    24605 (Nras)
   04213 Longevity regulating pathway - multiple species
    24605 (Nras)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24605 (Nras)
   05230 Central carbon metabolism in cancer
    24605 (Nras)
   05231 Choline metabolism in cancer
    24605 (Nras)
   05206 MicroRNAs in cancer
    24605 (Nras)
   05205 Proteoglycans in cancer
    24605 (Nras)
   05203 Viral carcinogenesis
    24605 (Nras)
   05214 Glioma
    24605 (Nras)
   05216 Thyroid cancer
    24605 (Nras)
   05221 Acute myeloid leukemia
    24605 (Nras)
   05220 Chronic myeloid leukemia
    24605 (Nras)
   05218 Melanoma
    24605 (Nras)
   05211 Renal cell carcinoma
    24605 (Nras)
   05219 Bladder cancer
    24605 (Nras)
   05215 Prostate cancer
    24605 (Nras)
   05213 Endometrial cancer
    24605 (Nras)
   05223 Non-small cell lung cancer
    24605 (Nras)
  Substance dependence
   05034 Alcoholism
    24605 (Nras)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    24605 (Nras)
  Infectious diseases
   05166 HTLV-I infection
    24605 (Nras)
   05161 Hepatitis B
    24605 (Nras)
   05160 Hepatitis C
    24605 (Nras)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    24605 (Nras)
   01522 Endocrine resistance
    24605 (Nras)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24605 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   24605 (Nras)
  Exosomal proteins of breast cancer cells
   24605 (Nras)
  Exosomal proteins of colorectal cancer cells
   24605 (Nras)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    24605 (Nras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 189 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGTQG
CMGLPCVVM
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggcgttgggaaaagtgctttgaca
atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtgattgacggtgagacctgtctactggacatactggacacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaagggttcctctgt
gtgtttgccatcaataatagcaaatcctttgcagatattaacctctacagggagcaaatt
aagcgcgtgaaagactctgatgatgtacccatggtgctggtagggaacaagtgtgacttg
ccaacaaggacagttgacacaaagcaagcccacgagctggccaagagttatggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaggatgccttttacacgcttgta
agggagatacgccagtaccggatgaagaagctcaacagcagtgaggatggcactcaaggc
tgtatggggctgccctgtgtggtgatgtag

DBGET integrated database retrieval system