KEGG   Rattus norvegicus (rat): 246074Help
Entry
246074            CDS       T01003                                 

Gene name
Scd1
Definition
stearoyl-Coenzyme A desaturase 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    246074 (Scd1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    246074 (Scd1)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    246074 (Scd1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    246074 (Scd1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     246074 (Scd1)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  First
   246074 (Scd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q54
AA seq 358 aa AA seqDB search
MPAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQD
EEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHR
LWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH
VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET
FLHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYH
HAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacatgctccaagagatctccagttcctacacgaccaccactaccatcaca
gagcctccttccggaaacctgcagaatggacgagagaagatgaagaaggtgcccctctat
ctggaagaagacatccgtcctgaaatgagagaagatatccacgaccccagctaccaggat
gaggaggggcccccgcccaagctggagtacgtctggaggaacatcatcctcatggccctg
ctgcacgtgggagccctgtacgggatcacactgatcccctcctccaaggtctacaccttg
ctctgggggatattttactaccttatcagtgccctgggcatcacagccggggctcatcgc
ctgtggagccacaggacttacaaggctcggctgcccctgaggatcttcctcatcattgcc
aacaccatggcgttccagaacgatgtgtatgaatgggcccgggatcaccgcgcccaccac
aagttctctgagacacacgccgaccctcacaactcccgccgtggctttttcttctctcac
gtgggttggctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaagctggac
atgtctgacctgaaagctgagaagctggtgatgttccagaggaggtactacaagcctggc
ctcctgctcatgtgcttcatcctgcccacactggtgccctggtactgctggggcgaaact
ttcctgcacagcctgttcgtcagcaccttcttgagatacactctggtgctcaacgccacc
tggctggtgaacagcgctgcccacctctatgggtatcgcccctacgacaagaacattcaa
tctcgggagaacatcctggtttccctgggtgccgtgggcgagggcttccacaactaccat
cacgccttcccctacgactactctgccagtgagtaccgctggcacatcaacttcaccacg
ttcttcatcgactgcatggctgccctgggcctggcttacgaccggaaaaaagtttctaag
gccgctgtcttagccaggattaagagaactggagatgggagccacaagagtagctga

DBGET integrated database retrieval system