KEGG   Rattus norvegicus (rat): 246185Help
Entry
246185            CDS       T01003                                 

Gene name
Dus1l, Pp3111, x85
Definition
(RefSeq) dihydrouridine synthase 1-like
  KO
K05542  
tRNA-dihydrouridine synthase 1 [EC:1.3.1.88]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.88  tRNA-dihydrouridine16/17 synthase [NAD(P)+]
     246185 (Dus1l)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    246185 (Dus1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.3
AA seq 438 aa AA seqDB search
MPKLQGFEFWSRALGGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANY
RKENLYCDVCPEDRPLIVQFCANDPEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGRYGA
FLQEEWDLLQRMILLAHERLSVPVTCKIRVFPEIDKTVRYAQMLEKAGCQLLTVHGRTKE
QKGPMAGTASWEHIKAVRKAVGIPVFANGNIRCLQDVERCIQDTGVQGVMSAEGNLHNPA
LFEGRSPAVWELADEYLDIVRQHPCPLSYVRAHLFKLWHHTLQVHQQLREELAKVKTLEG
VAAVSQALKLRCQEDMARQQEGVRPADNLPAFHWICQPYIRPGPKEGSKENSSGRSKRAL
EEEEGSMEGLSKNKLKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVFNLCRGCCKKR
AFRETADCPGHDCFLRPN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactgcagggttttgagttttggagccgcgcccttgggggtgcccgacatgtg
gtggcacccatggtggaccagagtgagctagcttggagactgctaagccgccgccatgga
gcccagctatgctacacccctatgctacatgcccaggtcttcgttagagatgctaactat
cggaaagagaacctatattgtgatgtgtgccctgaggacaggcccctcattgtgcagttt
tgtgccaacgacccagaggtgtttgtccaggcagctctcctagcacaagattactgtgat
gccattgacctgaacttgggctgcccacagatgatagccaagagaggtcgctatggcgct
tttctgcaggaggagtgggatcttcttcaaagaatgattctgttggctcatgagcgactc
tctgttcctgtcacgtgcaaaattcgtgtcttcccagagattgacaagacagtgagatac
gcccagatgctggagaaggctggctgtcagctcctgactgtgcatgggcgcaccaaggag
cagaaggggcccatggcaggaacagcctcgtgggagcacatcaaggcagttcggaaggcg
gtgggaatccctgtgtttgccaatgggaacatccggtgcctgcaggatgtggagcgatgc
atccaggacacaggcgtgcagggggtcatgagtgcagaggggaacctgcacaaccctgcc
ctctttgagggccggagccctgctgtgtgggagctggctgatgagtacctggacattgta
cggcagcacccttgtccactctcctacgtccgggcccatctcttcaagctgtggcaccac
acgctacaggtacatcagcagcttcgggaggagctggccaaagtgaagaccctggaaggc
gtggctgctgtgagccaggcgctgaagcttcgctgtcaggaggacatggccaggcagcaa
gaaggagtgaggccagctgacaacttacctgctttccactggatctgccagccttacatc
cgaccaggacctaaggaagggagcaaggagaatagtagtggtcgaagcaagcgggctctg
gaggaagaagagggcagcatggagggcttgtccaagaataagctgaagaaacaactgagg
aaccctcacaaaacatttgatccttccctgaaacccaaatatgcaaagtgtgaccaatgt
ggaaatccaaagggcaatagatgtgtgtttaatctgtgccgtggctgctgcaagaagcga
gctttcagggagaccgcagactgcccaggtcatgattgctttttaagaccaaattag

DBGET integrated database retrieval system